SecReT4
Protein ID: 348589269
T4SS name [ID]Tra_F [81]
Gene symboltraF
Locus tagPHK17A_p080
StrainEscherichia coli plasmid pHK17a (NC_016039)
Repliconplasmid pHK17a [GenBank: NC_016039] [Browse all T4SS(s) in this replicon]
Location [Strand]48962..49705 [+]
Productprotein TraF
Component typeTraF_F
UniProt IDG3G3S8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.9e-79, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|348589269|ref|YP_004870072.1| protein TraF [Escherichia coli]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|348589192|ref|NC_016039.1|:48962-49705 Escherichia coli plasmid pHK17a, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGGAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGTACCTGCAGCCCCCCGTCA
GGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCCATT
CTGTATCCCGGCGTGGATAATTTTGTTAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACATCCCGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTACGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGGACCCCATCGACGGGCAACTGGCGCAGGTCA
TTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCT
GTTGCCGGATTCCCGGACTGACCAAGGGCAGGCGCAGCGCCTCGGTGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTTCACAGGACGACCTGGCAA
AACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTTTTAA
 Primer design