SecReT4
Protein ID: 348589272
T4SS name [ID]Tra_F [81]
Gene symboltraQ
Locus tagPHK17A_p083
StrainEscherichia coli plasmid pHK17a (NC_016039)
Repliconplasmid pHK17a [GenBank: NC_016039] [Browse all T4SS(s) in this replicon]
Location [Strand]50457..50741 [+]
Productprotein TraQ
Component typeTraQ_F
UniProt IDB7LJ36, C8CGR7
KEGG IDeum:p1ECUMN_0088
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.4e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|348589272|ref|YP_004870075.1| protein TraQ [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|348589192|ref|NC_016039.1|:50457-50741 Escherichia coli plasmid pHK17a, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design