SecReT4
Protein ID: 348589283
T4SS name [ID]Tra_F [81]
Gene symboltraX
Locus tagPHK17A_p094
StrainEscherichia coli plasmid pHK17a (NC_016039)
Repliconplasmid pHK17a [GenBank: NC_016039] [Browse all T4SS(s) in this replicon]
Location [Strand]65799..66545 [+]
Productprotein TraX
Component typeTraX_F
UniProt IDG3G3U2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 6.4e-53, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|348589283|ref|YP_004870086.1| protein TraX [Escherichia coli]
MTTDNTNTTRNDSLAARTDTWFQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERLALLACLLAVIPALNLASSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|348589192|ref|NC_016039.1|:65799-66545 Escherichia coli plasmid pHK17a, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTTCAGT
CATTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCGCTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCGGTCAGTTACCGACTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGCTTGCATGCCTGCT
GGCCGTTATTCCGGCACTTAACCTTGCCTCCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design