SecReT4
Protein ID: 350273350
T4SS name [ID]VirB [426]
Gene symbolvirB8-1
Locus tagRJP_0307
StrainRickettsia japonica YH
Repliconchromosome [GenBank: NC_016050] [Browse all T4SS(s) in this replicon]
Location [Strand]393469..394110 [-]
ProductvirB8 protein
Component typeVirB8
UniProt IDG4KML6
KEGG IDrja:RJP_0307
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.4e-18, Aligned region: 12..203
Protein Sequence: 213 a.a.     [Download]
>gi|350273350|ref|YP_004884663.1| virB8 protein [Rickettsia japonica YH]
MQEKWYNFKYILPLSHRSLLLLICTIFTLLLTLICININILLPINKKVSYLIKDDAAKQAAVTNTKHSTL
TNPYISIANIMLQNYVKQREEYNYDILKEQFTFIKNASTSIVYMQFANFMNIDNPLSPVIRYQKLYRRSI
NILSINNINDNEAVVTFESLAKNSTDAILENMVWEARIGFIMDSISTNTSPDMPFNFTVTSYKLKLLRNK
NQK
 
Nucleotide Sequence: 642 bp     [Download]
>gi|350273053|ref|NC_016050.1|:c394110-393469 Rickettsia japonica YH, complete genome
ATGCAAGAAAAATGGTATAATTTTAAGTATATCTTACCATTAAGTCATAGAAGTCTTCTGCTTTTAATAT
GCACGATTTTTACCTTATTATTAACCTTAATTTGTATAAATATCAATATATTGCTACCTATAAACAAAAA
AGTAAGTTATTTAATAAAAGATGATGCTGCAAAACAAGCTGCCGTTACTAATACTAAACATTCAACATTA
ACAAATCCTTATATCTCTATTGCAAATATTATGCTTCAGAATTATGTAAAGCAACGAGAAGAATACAATT
ACGATATATTAAAAGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGC
TAATTTTATGAATATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATT
AATATATTATCAATTAACAATATAAACGATAACGAGGCAGTTGTTACTTTTGAATCATTGGCAAAAAATA
GTACGGATGCAATTTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTAC
AAATACATCACCTGATATGCCGTTCAATTTTACCGTTACTAGTTACAAGCTAAAGTTATTAAGGAATAAA
AATCAGAAATAA
 Primer design