SecReT4
Protein ID: 350273351
T4SS name [ID]VirB [426]
Gene symbolvirB8-2
Locus tagRJP_0308
StrainRickettsia japonica YH
Repliconchromosome [GenBank: NC_016050] [Browse all T4SS(s) in this replicon]
Location [Strand]394861..395592 [+]
ProductvirB8 protein
Component typeVirB8
UniProt IDG4KML7
KEGG IDrja:RJP_0308
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.3e-45, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|350273351|ref|YP_004884664.1| virB8 protein [Rickettsia japonica YH]
MNNIFGFFKSRNNSQVGSGDAQTQESIKSANPLKITQNWYEERSDKLLVQRNLLIILIILLTVFMVIATL
VIAFVVKSKQFEPFVIQLNSSTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEENTTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDVNPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|350273053|ref|NC_016050.1|:394861-395592 Rickettsia japonica YH, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGGAATAACTCGCAAGTCGGTTCAGGAGATGCACAAACAC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTACTTATCATATTAATAATACTACTAACTGTTTTTATGGTTATAGCAACTTTA
GTAATAGCCTTTGTAGTAAAATCTAAACAGTTTGAGCCTTTTGTTATTCAGCTTAATAGTAGTACCGGAC
GTGCCTCGGTGGTAGAACCTATTTCATCACCAGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCGGTTGATTTTGCAACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTTTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGAGAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGAAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATGTAAATCCTGTAGGGTTTCAAGTGA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design