SecReT4
Protein ID: 350273354
T4SS name [ID]VirB [426]
Gene symbolvirB11
Locus tagRJP_0311
StrainRickettsia japonica YH
Repliconchromosome [GenBank: NC_016050] [Browse all T4SS(s) in this replicon]
Location [Strand]397679..398683 [+]
ProductvirB11 protein
Component typeVirB11
UniProt IDG4KMM0
KEGG IDrja:RJP_0311
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.7e-94, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|350273354|ref|YP_004884667.1| virB11 protein [Rickettsia japonica YH]
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLALGSLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNLTLDEYAKMGAFDDTATESLIDEDAVIL
NNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMI
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|350273053|ref|NC_016050.1|:397679-398683 Rickettsia japonica YH, complete genome
ATGAGTGAAGAATTTGCAGCCTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAAATTATGGTTAATAAGCCCGGAGAAGTATGGGTTGAAAAAAAAGGCGATATATATTCTAAGCA
AATACCGGAACTGGATAGCGAACATCTACTTGCATTAGGGAGTTTAGTAGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAACCGCTTCTTTCGGCAACTTTGCCGAATGGCTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATGCTATAAGAAAGCCTAGCGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGGGCATTTGATGATACTGCAACAGAGAGTTTAATAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTCACTGAAATACCTGCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCAAGCCATCCTAACAGAGTGCATTTA
CTGGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTT
TAAGACCAGATAGGATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGCCATCCCGGTTCAATATCAACACTGCATGCTGATAGTCCTGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCGGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAGAACGCTGAGGGGATGATTTAA
 Primer design