SecReT4
Protein ID: 350273355
T4SS name [ID]VirB [426]
Gene symbolvirD4
Locus tagRJP_0312
StrainRickettsia japonica YH
Repliconchromosome [GenBank: NC_016050] [Browse all T4SS(s) in this replicon]
Location [Strand]398836..400611 [+]
ProductvirD4 protein
Component typeVirD4
UniProt IDG4KMM1
KEGG IDrja:RJP_0312
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.7e-166, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 3.1e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 8.4e-22, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.5e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|350273355|ref|YP_004884668.1| virD4 protein [Rickettsia japonica YH]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGALGVNINAINIAYKWAYWLINVWGQLK
IADYNYLKLKLLASLLSPAIIVIIFYIKNFERIKSLQFFKQDEKVYGDASWANPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGITHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFDPRANNNEASEETETITVPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|350273053|ref|NC_016050.1|:398836-400611 Rickettsia japonica YH, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGAAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGTACCATTTGGATAAGTGGTGCATTTGTTGCAATTTTTACTAATGAGGTTGGAGCTTTAGGTGT
AAATATAAATGCTATAAATATTGCTTATAAGTGGGCTTACTGGCTTATTAACGTTTGGGGGCAGTTAAAA
ATTGCCGACTATAATTATTTAAAATTGAAGCTACTTGCCTCTCTTCTCAGTCCAGCTATTATTGTTATAA
TATTTTACATTAAAAATTTTGAAAGAATAAAATCATTACAATTTTTCAAACAAGATGAAAAAGTATATGG
AGATGCAAGCTGGGCTAATCCGTCAGATATAGAGGCTGCAGGTCTTAGATCTAAGAAAGGTATGCTGATC
GGTGTTGATGCCGGTGGATATTTTGTTGCAGACGGGTTCCAGCATGCTTTATTATTTGCTCCTACCGGTT
CAGGTAAAGGTGTAGGGTTTGTGATACCTAACTTGTTATTTTGGAGTGATTCGGTAGTAGTGCATGACAT
AAAGCTCGAAAATCACGGGTTGACAAGTGGTTGGCGTGAGAAGCAAGGGCAGAAAGTTTTTGTATGGGAG
CCTTCTAATCCTGATGGTATTACTCATTGTTATAATCCGATTGATTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGACGTTCAAAAAATTTCAAATCTTATAATGCCGGAAAAGGATTTTTGGAATAATGAGGCACG
AAGCTTATTTTTAGGCGTAACTCTATATTTAATAGCCGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACTATGAGGAGTGACGACGTAGTTTATAATCTAGCGGTCGTACTCGATACGCTTGGTGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCATTTTTGCAAAAAGCCGATAAAGAGCGTTCCGGCGTAAT
ATCTACAATGAACTCATCGCTTGAATTATGGGCAAATCCACTTATTGATTCAGCTACAGCATCTTCTGAT
TTCAATATACAAGAATTTAAAAAAGTAAAAACAACCGTATATGTAGGGTTAACACCCGATAATATACAGC
GTTTACAAAAATTAATGCAGGTGTTTTATCAGCAGGCGACAGAATTTTTAAGCCGCAAAATGCCGGATTT
AAAGGAAGAGCCGTATGGAGTAATGTTCTTACTTGACGAGTTCCCGACGCTCGGGAAGATGGATACTTTT
AAAGCCGGTATAGCTTATTTTAGAGGTTATAGAGTTCGTTTATTTTTAATTATTCAAGATACACAGCAGT
TAAAAGGAACATATGAAGATGCAGGAATGAATTCTTTCTTATCTAATGCAACATATCGTATTACTTTTGC
CGCTAATAACTATGAAACGGCAAATTTAATATCACAGCTTGTCGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGATCTTAATATTTCTACTAGAACTCAAAACGTTTCTCAGGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
GCCTATAAAATCTCGTAAAATTAAGTATTACGAAGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGACCCTAGGGCAAATAATAATGAGGCTTCTGAAGAGACCGAAACAA
TAACTGTTCCGGAAAATAATGAGTAA
 Primer design