SecReT4
Protein ID: 37525034
T4SS name [ID]Tfc [746]
Gene symbolpilL
Locus tagplu1049
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1227925..1228974 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDQ7N7Q9
KEGG IDplu:plu1049
PDB IDNA
Domain hit(s) vs Pfam TcpQ [PF10671], Evalue: 6.9e-23, Aligned region: 261..346
Protein Sequence: 349 a.a.     [Download]
>gi|37525034|ref|NP_928378.1| hypothetical protein plu1049 [Photorhabdus luminescens subsp. laumondii TTO1]
MKNPVFFSLSWVLVMVLAGCAGQTQEATASGVSFHRSHQASPAVSDIYSLTPEVTRYDRYTLVSVGSQAV
QREPLNQIINITMPVPLVQRIGDGLHYLLFGTGYSLCDTTATHFVKLIGRPLPAIQRKMGPIRLSEALQI
VVGPAWRIRVDEVNREVCFVLRDEYRQFSETTVGRITQPKMRVPLQIASSPALSASTLSNSTLATPLPVK
PLIAERPKTDTLQSSVTGGKSTTISSVSPTQPIKSLLSGSTPVATVPIGNIWRAETGTTLRGTLERWANT
TDCPVGGHWVVVWSSPTDYRIDAPLMFKGNFESLLVQVFDLYRQAEKPLFAEVSRLQCLISVSDKPVTR
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1227925-1228974 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAAAACCCTGTTTTTTTCTCACTCAGTTGGGTGCTCGTCATGGTATTAGCTGGGTGTGCCGGACAAA
CTCAGGAGGCTACCGCATCCGGTGTAAGTTTTCACCGTTCTCATCAGGCAAGTCCCGCTGTATCCGATAT
CTATTCTCTGACACCAGAAGTTACACGCTATGATCGCTATACCTTGGTGAGTGTAGGCAGCCAGGCTGTG
CAGCGTGAACCCCTCAATCAAATCATCAATATCACCATGCCAGTACCATTGGTACAACGCATTGGTGATG
GATTGCACTATCTGCTTTTTGGAACAGGTTATTCGCTGTGTGATACCACCGCAACCCATTTCGTTAAATT
GATAGGCAGACCATTACCGGCTATTCAACGCAAAATGGGGCCGATACGGCTCAGTGAAGCGTTACAGATT
GTTGTCGGGCCAGCATGGCGTATCCGGGTAGATGAGGTGAATCGTGAAGTGTGTTTTGTTTTACGTGATG
AATATCGTCAGTTTTCCGAGACAACGGTTGGCCGGATAACACAGCCCAAAATGCGGGTACCGTTGCAAAT
AGCTTCTTCACCGGCGTTATCGGCATCTACATTGTCCAATAGCACATTAGCCACGCCGTTACCGGTGAAG
CCCCTGATAGCTGAAAGACCGAAAACAGATACCCTTCAATCTTCTGTGACAGGAGGGAAATCCACAACCA
TTTCTTCAGTATCACCTACTCAGCCCATTAAATCCCTGCTGAGCGGCAGTACACCAGTGGCAACGGTACC
GATAGGCAACATCTGGCGTGCGGAAACAGGAACCACTTTGCGTGGAACGTTGGAGCGGTGGGCTAATACA
ACGGATTGCCCGGTAGGGGGACACTGGGTAGTGGTGTGGTCGTCACCGACGGATTACCGCATTGATGCGC
CGTTGATGTTCAAAGGCAACTTTGAGTCCTTGTTGGTACAAGTGTTTGATCTTTATCGACAGGCTGAGAA
GCCATTGTTTGCCGAAGTCAGCCGCCTTCAGTGCCTGATTTCAGTCAGTGATAAACCGGTGACCCGGTAA
 Primer design