SecReT4
Protein ID: 37525053
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1068
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1243690..1244427 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDQ7N7P3
KEGG IDplu:plu1068
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|37525053|ref|NP_928397.1| hypothetical protein plu1068 [Photorhabdus luminescens subsp. laumondii TTO1]
MRKDFFSQRKGVVLIGVVMSLSASAAQVAISEQTETGMKATQQQVTQAENHRIQAQMWGLTEAEFQRYQQ
LMQGQRGIQSPGLDPLSALGIEAETVQARQRYAELWVRQEYVRTEKELAFQRAVDAAWKRLAPNILPVNL
GKGDGIAQGNQGRLVLFVKEDCAACDARLAAVLSADREVDIYLVDSEGNDDVLRTWAGKHHIPSEKVRSR
KITLNHDKGRWRQFGQGKMPVVLQHENDGWRVVAF
 
Nucleotide Sequence: 738 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1243690-1244427 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAGAAAAGATTTTTTCAGCCAGAGGAAGGGAGTGGTGCTGATTGGCGTTGTTATGTCTCTGTCAGCTT
CGGCGGCACAGGTTGCTATCTCTGAACAGACAGAGACGGGAATGAAAGCGACTCAGCAACAGGTCACGCA
GGCTGAAAACCACCGTATTCAGGCGCAAATGTGGGGACTGACAGAAGCAGAGTTTCAGCGTTATCAGCAA
TTGATGCAGGGGCAACGGGGCATTCAGTCTCCTGGGCTCGATCCGTTGAGTGCATTGGGTATTGAGGCCG
AAACAGTACAAGCGCGTCAACGTTATGCCGAACTGTGGGTTAGGCAGGAATATGTTCGTACTGAAAAGGA
ACTGGCGTTCCAGCGGGCGGTGGATGCGGCCTGGAAGCGTCTGGCGCCGAATATTTTGCCGGTTAATTTA
GGGAAGGGGGACGGAATCGCACAGGGTAATCAAGGGCGGCTGGTGTTATTTGTGAAAGAGGATTGCGCGG
CTTGTGATGCCCGGCTGGCTGCTGTCTTGTCAGCTGACCGTGAGGTGGATATTTACCTGGTAGATAGCGA
AGGCAACGATGATGTTTTACGTACCTGGGCAGGTAAACATCATATTCCCTCAGAAAAAGTCCGTAGCCGA
AAAATCACGCTTAATCATGACAAAGGGCGCTGGCGACAATTTGGTCAGGGGAAAATGCCGGTCGTACTAC
AACATGAGAATGACGGATGGCGTGTGGTGGCATTTTGA
 Primer design