SecReT4
Protein ID: 37525054
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1069
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1244457..1245029 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ7N7P2
KEGG IDplu:plu1069
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 190 a.a.     [Download]
>gi|37525054|ref|NP_928398.1| hypothetical protein plu1069 [Photorhabdus luminescens subsp. laumondii TTO1]
MTEGMAAAVKQVVPPGYQQIARVHGVPVEMLYALALAESAKRLPQEKHERPWPWTLNVAGKSYRYATRQA
VWQALQGFMRSVPLKRIDVGITQVNLGWNGHYFRSYWDALDPYTNLHVAARILKTCYQSNPGSWLNAAGC
YHHPAGGQPASKYRKIVARKLSTLETRYPVLSTNIAVVNTTQTWIEPKEK
 
Nucleotide Sequence: 573 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1244457-1245029 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
GTGACAGAAGGTATGGCCGCGGCGGTAAAACAGGTTGTTCCGCCTGGGTACCAGCAGATTGCGCGGGTGC
ATGGCGTACCCGTTGAAATGCTTTATGCGTTGGCACTGGCTGAATCGGCAAAACGTTTGCCACAGGAGAA
ACATGAACGCCCCTGGCCGTGGACGCTCAATGTGGCTGGAAAAAGTTATCGTTATGCAACCCGACAGGCG
GTCTGGCAGGCGTTGCAGGGATTTATGCGCAGCGTACCCCTCAAACGTATTGATGTGGGGATTACTCAAG
TGAATTTAGGCTGGAACGGCCATTATTTTCGTTCTTATTGGGATGCCTTGGACCCCTATACTAATCTTCA
TGTGGCAGCTCGTATTCTGAAAACCTGTTATCAATCCAATCCGGGTAGTTGGTTGAATGCGGCAGGCTGT
TATCACCATCCCGCTGGCGGTCAACCCGCGAGTAAGTATCGGAAAATCGTCGCACGTAAACTGAGTACGC
TAGAGACCCGATATCCTGTTTTGTCCACCAATATTGCTGTAGTTAATACGACACAGACCTGGATTGAACC
GAAGGAAAAATAA
 Primer design