SecReT4
Protein ID: 37525055
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1070
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1245035..1245571 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDQ7N7P1
KEGG IDplu:plu1070
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 5.7e-49, Aligned region: 31..173
Protein Sequence: 178 a.a.     [Download]
>gi|37525055|ref|NP_928399.1| hypothetical protein plu1070 [Photorhabdus luminescens subsp. laumondii TTO1]
MLIHNLIRYRCRLFLMMMILTPCSQAALTIVADLGGQSTAAYFDAINAQDNEPTTSSNTEATPPDLTEGG
ILPVETPELSPGPVDARPLQLPGMGALFMIGDDARSKQWLKENLVGLRKKQAVGLLVSVRDKAQLDELRQ
LAEGLVLAPASGSDLARRLNLRHYPVLITDIGLTQQVR
 
Nucleotide Sequence: 537 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1245035-1245571 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTTAATCCATAACTTAATCCGTTATCGCTGCCGTTTATTTTTAATGATGATGATATTGACGCCCTGTT
CTCAGGCTGCACTGACTATTGTGGCTGATTTAGGTGGACAATCTACAGCAGCGTATTTTGATGCCATTAA
CGCTCAGGACAATGAACCGACGACTTCTTCAAATACGGAGGCGACCCCGCCAGATTTGACCGAAGGGGGC
ATTTTACCGGTGGAAACGCCGGAATTGTCTCCCGGACCTGTTGACGCTCGTCCGTTGCAATTGCCAGGAA
TGGGAGCGTTGTTCATGATTGGGGATGATGCCCGGTCAAAACAGTGGTTGAAGGAAAATTTGGTTGGCCT
TCGGAAAAAGCAGGCGGTGGGGTTGCTGGTCAGTGTGCGGGATAAAGCACAACTGGATGAACTGCGTCAG
CTTGCAGAGGGATTAGTATTAGCCCCCGCTTCCGGCAGTGATTTGGCCCGGCGGTTGAATTTGCGGCATT
ACCCAGTGTTGATAACCGATATCGGTTTAACTCAGCAGGTGCGTTGA
 Primer design