SecReT4
Protein ID: 37525057
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1074
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1249310..1250062 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ7N7P0
KEGG IDplu:plu1074
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.7e-72, Aligned region: 48..247
Protein Sequence: 250 a.a.     [Download]
>gi|37525057|ref|NP_928401.1| hypothetical protein plu1074 [Photorhabdus luminescens subsp. laumondii TTO1]
MTQQNTKSQQMPAKKSGPLKTVLWDMPWMLIGFLLVSLFFSLVIEYLGIAFFWPEQGERHSQQVMITESG
WLSKEFTRSLLLSEPATTLSIGLKWSYQWVFVDSGALDWINQQHTVQARSHYEMVRELSDWSVLLAESLR
KYLLATVYVTVTFIIRLTILVLSLPLFVMVIGVAVVEGLNRRDLRRYGAAYESSFVYHHAKRFVKPAFCV
PCLLYLSWPSAVYPNLLLLPAAILLGVAITVMMSTFKKYL
 
Nucleotide Sequence: 753 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1249310-1250062 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACGCAACAGAACACTAAATCGCAGCAGATGCCAGCGAAAAAATCAGGTCCGTTAAAAACGGTCCTGT
GGGATATGCCATGGATGCTTATTGGCTTCCTGCTGGTATCGTTGTTTTTTAGTTTGGTGATTGAATACCT
TGGGATAGCCTTTTTCTGGCCGGAACAGGGAGAGAGACACAGCCAGCAAGTGATGATCACGGAAAGCGGT
TGGTTGTCTAAAGAATTTACCCGCAGCTTACTGTTATCAGAGCCCGCTACTACGCTCAGTATCGGGTTAA
AATGGAGTTATCAGTGGGTGTTTGTAGACAGTGGTGCACTGGACTGGATTAACCAACAGCATACAGTACA
AGCTCGGAGCCACTATGAGATGGTGAGAGAGTTGAGCGATTGGAGTGTATTACTGGCGGAAAGTTTGCGG
AAGTACTTGCTGGCAACGGTATATGTGACCGTAACCTTTATTATCCGGCTCACTATTCTGGTGTTGTCTT
TGCCATTGTTTGTGATGGTTATAGGCGTTGCTGTCGTTGAAGGACTAAACCGACGTGACCTGCGGCGTTA
TGGTGCCGCTTATGAGTCGAGTTTTGTTTATCATCATGCCAAACGGTTTGTGAAACCGGCGTTTTGTGTA
CCCTGTCTGTTATATCTCTCCTGGCCATCGGCTGTGTATCCCAATTTATTATTGTTACCCGCAGCTATCC
TATTAGGGGTCGCTATTACCGTGATGATGAGTACTTTTAAGAAATATCTTTGA
 Primer design