SecReT4
Protein ID: 37525059
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1078
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1251860..1252135 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ7N7N8
KEGG IDplu:plu1078
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.5e-27, Aligned region: 3..85
Protein Sequence: 91 a.a.     [Download]
>gi|37525059|ref|NP_928403.1| hypothetical protein plu1078 [Photorhabdus luminescens subsp. laumondii TTO1]
MSWPVLAGEKDELATTLKQLDQVQASLERARVLAIQEGQADRFYFDYLRANRDLNIVREGINRYLTPSRA
QPGISAAALDVTGQYRQERIR
 
Nucleotide Sequence: 276 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1251860-1252135 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAGTTGGCCTGTGCTGGCTGGGGAAAAAGATGAGCTGGCCACCACACTCAAACAGCTTGATCAGGTGC
AGGCCAGTTTGGAACGTGCCCGGGTTTTGGCCATTCAGGAGGGTCAGGCAGACCGTTTTTATTTTGATTA
TCTACGTGCTAACCGGGACCTCAATATTGTCCGTGAAGGCATTAACCGCTATCTGACCCCCTCCCGTGCC
CAGCCCGGGATTTCTGCGGCTGCGCTGGATGTGACCGGTCAGTATCGTCAGGAGCGAATACGGTGA
 Primer design