SecReT4
Protein ID: 37525062
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1081
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1252813..1253190 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ7N7N5
KEGG IDplu:plu1081
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.6e-43, Aligned region: 3..118
Protein Sequence: 125 a.a.     [Download]
>gi|37525062|ref|NP_928406.1| hypothetical protein plu1081 [Photorhabdus luminescens subsp. laumondii TTO1]
MVQTIRFLPDRLNAEPVVFRGFTTPELGWTALTGLIAGAVIGLLLASVTGWVMIPTAALIAPLLLIAFGG
KYLARMKRGKPAHYLYRRLEVKKRCWGLGDPLLIITSQRWSLRRRHRVMTRMGRL
 
Nucleotide Sequence: 378 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1252813-1253190 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGTTCAGACTATTCGTTTTTTACCTGACCGTCTTAACGCCGAACCTGTCGTGTTCCGGGGATTTACTA
CCCCAGAACTGGGCTGGACGGCATTAACGGGATTGATAGCTGGCGCGGTCATTGGCTTGTTACTGGCATC
GGTAACGGGGTGGGTGATGATACCGACGGCGGCACTGATTGCGCCGTTGTTATTGATTGCCTTTGGCGGC
AAATACCTGGCCCGGATGAAACGCGGTAAACCGGCGCATTATCTCTATCGACGGCTGGAGGTTAAAAAGC
GGTGCTGGGGTCTGGGTGACCCGTTACTGATTATCACCTCACAACGCTGGTCATTGCGCCGCCGTCACCG
GGTAATGACCCGAATGGGGCGGTTATGA
 Primer design