SecReT4
Protein ID: 37525063
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1082
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1253840..1254763 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDQ7N7N4
KEGG IDplu:plu1082
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1e-116, Aligned region: 12..301
Protein Sequence: 307 a.a.     [Download]
>gi|37525063|ref|NP_928407.1| hypothetical protein plu1082 [Photorhabdus luminescens subsp. laumondii TTO1]
MNKQVLVELLALTALLFAGLVMVSPVEAVELMKWERIPLPVALHVGQERVVFVDKNVRVGFPGALDGKLR
IQSTGGAVYLYPSETFTQTRLQLQDVESGEVILLDVTATNGKDPLEPVRVVYHGDVITLTDDHQIHHGAK
GDNTSATSPSLAGERQAARRQKPSYTAPLPVVLTRYAAQSLYAPLRTVEAVPGIHPVSLALSPRLTTLYP
SAPVIVSPLGGWGVDNLTVVALKVRNTHRENVVLDPRRLQGQFIAATFQHRWLGPSGTPEDTTTVYLVVK
GRPDRAFLPEPVRSKTPMKRQGNPHAN
 
Nucleotide Sequence: 924 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1253840-1254763 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
GTGAACAAACAGGTACTCGTCGAGTTATTGGCATTGACCGCATTATTATTCGCCGGGCTGGTGATGGTTT
CACCCGTTGAGGCCGTGGAGTTGATGAAGTGGGAGCGTATCCCGCTGCCGGTTGCCTTGCATGTTGGGCA
GGAGCGGGTGGTTTTTGTAGATAAAAATGTCCGAGTCGGTTTTCCGGGTGCGCTGGATGGCAAATTGCGG
ATACAAAGCACCGGTGGTGCAGTGTATCTGTATCCGAGTGAAACGTTTACCCAGACCCGACTGCAACTTC
AGGATGTGGAAAGTGGGGAAGTGATTTTACTGGATGTGACAGCTACAAATGGAAAAGATCCCCTTGAGCC
GGTTCGGGTGGTGTACCACGGGGACGTGATTACGTTGACGGATGACCATCAGATTCATCATGGTGCCAAA
GGGGATAACACGTCAGCAACGTCTCCCTCTCTTGCCGGTGAACGTCAGGCCGCCCGGCGTCAAAAACCGT
CCTATACGGCTCCGCTGCCGGTGGTCCTGACCCGTTATGCTGCGCAGAGTCTGTATGCGCCGTTGCGTAC
AGTAGAAGCTGTTCCCGGCATTCACCCGGTATCATTGGCATTGTCGCCCCGATTGACCACATTGTATCCC
TCTGCGCCGGTAATAGTTTCCCCGTTAGGGGGCTGGGGGGTGGATAACCTCACTGTGGTGGCGCTGAAAG
TGCGTAATACCCACCGTGAGAACGTAGTGCTTGATCCACGCAGGTTGCAGGGGCAATTCATAGCAGCGAC
CTTTCAGCATCGTTGGTTGGGGCCGTCGGGTACGCCGGAAGACACGACTACCGTCTATTTGGTGGTGAAA
GGTCGGCCTGACCGTGCCTTTCTGCCTGAACCGGTGAGGTCAAAAACGCCTATGAAGCGACAAGGAAATC
CCCATGCAAATTAA
 Primer design