SecReT4
Protein ID: 37525064
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1083
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1254753..1256231 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDQ7N7N3
KEGG IDplu:plu1083
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 492 a.a.     [Download]
>gi|37525064|ref|NP_928408.1| hypothetical protein plu1083 [Photorhabdus luminescens subsp. laumondii TTO1]
MQIKSNGLVKWVVPAFVIAGLVVGIKSCRQSETPVSQTVSHQALAELSSGELRALGIEGDTPEDTLRTLI
GALRSIRVQQAALEKQNAQLLADNEKWRNGSQSMTDQINRVVAGTREETEKQQQLLKAEQQTLFSRLDQL
TRQLGNKGMNINNSLVERDIPLGLGLDNTGQNTTSGGDRLVWITPQDTLPVDSQVAMSGQPASPRFPVSF
LEDNALSRQKVEYDGITKNQRAITEDHTNEIIRPVYTLPENTTLVGSQAMTALLGRVPVNDKVTDPYPFK
VLIGKDNLTANGIELPDVEGAIVSGMATGDWTLSCVRGNVTSLTFVFADGTVRTVPKSDNRTNGSHHVQD
NSSGGIGWLSDNNGIPCISGERKSNASSYLPTLFALSGGTAAGDVLSQSQLTTQTNGYGGATSSLTGDAG
KAVLGQAAAGGFKAVSEWVKARYGQTFDAVYVPPGARVAVHITQQIPIDYEERGRRVKYNLGLGQEVRDG
LD
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1254753-1256231 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGCAAATTAAGTCAAATGGTCTGGTGAAGTGGGTCGTGCCTGCTTTTGTTATTGCGGGGCTGGTCGTGG
GGATCAAGAGTTGTCGGCAATCAGAGACGCCTGTCAGCCAGACAGTGAGTCATCAGGCTTTGGCGGAACT
GTCTTCCGGGGAGCTGCGGGCATTGGGGATTGAGGGGGATACCCCGGAAGACACGTTGCGCACCTTGATT
GGAGCTTTGCGCAGTATCCGTGTTCAGCAGGCGGCGCTGGAAAAACAAAACGCACAATTACTGGCGGACA
ATGAGAAATGGCGAAACGGCAGTCAGAGCATGACTGACCAGATTAACCGGGTGGTAGCGGGTACCCGTGA
GGAAACAGAAAAGCAACAGCAGCTATTGAAAGCGGAGCAGCAAACGCTGTTCAGCCGACTTGACCAGTTG
ACCCGTCAGTTAGGCAATAAGGGCATGAATATAAACAACTCTCTGGTTGAGCGTGATATTCCGCTGGGAT
TAGGGTTGGACAATACCGGCCAAAATACGACCTCTGGCGGGGACCGGTTGGTCTGGATTACCCCACAGGA
TACGTTACCGGTTGATTCACAGGTTGCAATGAGCGGTCAGCCAGCGTCCCCCCGTTTTCCCGTGTCATTT
CTGGAGGACAATGCATTGAGCCGTCAGAAAGTGGAATATGACGGTATAACTAAAAATCAGCGAGCCATTA
CCGAGGATCATACAAACGAGATTATCCGGCCCGTTTATACCCTGCCCGAGAATACGACGCTGGTCGGCAG
CCAGGCGATGACTGCATTATTAGGCCGGGTGCCAGTAAATGACAAAGTCACTGACCCGTATCCTTTTAAG
GTACTGATTGGTAAAGATAACCTGACTGCCAACGGCATTGAATTGCCGGATGTCGAAGGGGCGATTGTTT
CTGGTATGGCTACCGGTGACTGGACCTTGTCTTGCGTGCGCGGCAATGTCACATCTTTAACTTTTGTCTT
TGCAGACGGTACCGTCAGAACTGTGCCGAAATCGGATAATCGCACCAATGGCAGCCATCACGTTCAGGAT
AATAGCAGCGGTGGTATCGGCTGGCTATCTGACAACAACGGTATTCCGTGTATCAGCGGTGAACGTAAAT
CCAATGCATCCAGTTATTTACCAACCTTATTTGCTCTTTCTGGTGGCACAGCTGCGGGCGATGTGTTGTC
ACAGAGTCAGCTTACCACCCAGACTAACGGTTATGGCGGTGCGACGTCATCACTGACCGGGGATGCCGGT
AAAGCGGTTTTGGGGCAAGCCGCTGCCGGAGGATTTAAGGCCGTATCCGAATGGGTCAAAGCTCGTTATG
GCCAAACTTTTGATGCCGTTTACGTACCGCCGGGTGCCAGAGTAGCCGTGCACATTACCCAGCAAATACC
GATTGATTATGAAGAGCGGGGACGCAGGGTGAAATATAACTTAGGTCTTGGACAGGAGGTCCGTGATGGT
CTGGACTGA
 Primer design