SecReT4
Protein ID: 37525065
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1084
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1256218..1256646 [+]
Producthypothetical protein
Component typeTfc15
UniProt IDQ7N7N2
KEGG IDplu:plu1084
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|37525065|ref|NP_928409.1| hypothetical protein plu1084 [Photorhabdus luminescens subsp. laumondii TTO1]
MVWTEKTSMNKARKIVMLVVITILTGCSTSKEEMLPPGDSTMLALWQGKASSSQTTMKVRKTLRRELSER
EQQATLNYTESYSRTQENEISQTFPRLPNPDMVMYLFPHLVAGNTPVPGYSTVFSFYNQVQYALLGERTE
AL
 
Nucleotide Sequence: 429 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1256218-1256646 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGTCTGGACTGAGAAAACGAGCATGAATAAAGCGCGAAAAATAGTGATGTTGGTGGTGATAACGATCC
TGACCGGTTGCAGCACGTCTAAAGAAGAGATGCTTCCGCCGGGAGACAGCACAATGCTAGCTCTGTGGCA
GGGAAAAGCCTCGTCGTCACAGACTACAATGAAGGTCCGTAAAACACTGCGCCGGGAGCTGAGCGAACGG
GAACAGCAGGCTACTCTGAATTACACTGAAAGTTATAGCCGTACACAGGAAAATGAAATCAGTCAGACTT
TCCCTCGGTTGCCCAATCCAGACATGGTGATGTACCTCTTTCCTCATTTAGTTGCGGGAAACACGCCAGT
ACCGGGATACAGCACGGTGTTTTCGTTCTACAACCAGGTGCAATATGCTTTGCTGGGTGAACGGACGGAG
GCATTGTGA
 Primer design