SecReT4
Protein ID: 37525066
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1085
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1256643..1259525 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDQ7N7N1
KEGG IDplu:plu1085
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.2e-67, Aligned region: 58..324
AAA_10 [PF12846], Evalue: 9.6e-45, Aligned region: 517..859
Protein Sequence: 960 a.a.     [Download]
>gi|37525066|ref|NP_928410.1| hypothetical protein plu1085 [Photorhabdus luminescens subsp. laumondii TTO1]
MMWSLLNKVRLRKWDNLSEVLGETEVILPSSSTVVGREPLRRPGKMTSTDEAALYDTWPSIIDYLPWVEY
LDDEKCLLLDDGLSVGAIYAVSPVSTEGRTTARLEDIRDQVEDALQDSLEDDDVSPWVVQFFCQDEDDPA
LYLTQLRQYIKPWAQGSAFTEAWLAETERHLKGIARPEGLFNDSLVTGQSWRGQQRRTRMVIYRWAPVGQ
KESLLPIVLLNQVCDRLTASLASTGILCQRQNGEQVHHWLLRLFNPDPDWIDKATLYQAASYATPQAGER
KPDNDFTETLWFTPPRSDVKNGVWWFDNIAHRAVPVERLRRPPEPGTLTGEMVRGENINALMDLLPSGTI
VSLTVVAQAQDTLEQDFDRLSKNAVGENTESGRVRSDVKEAKAHLGLRHKLCRSALTFLLQGADVDDLNR
RHQQLAATLLVSGLQPVKPECDVAPLNGYLRALPMCFNPQRDKHHWYTRLTWMQHVAGLLPVTGRATGTG
NPGLSFFNRGGDVLTFDPQNKHDRTQNAHLLLFGPTGAGKSATLCASLSQLMAVHCPRLFVAEAGNSFGL
FADYCQRLGLSVNKISIKPGCGVSLALFADAHQLLQVASSQLDLAGERSAEETADDEADEQRDILGEIEL
AARMMITGGEKKEEERLTRADRGMIREAIMIAARASFDDGRQMIAEDLQNALSVIARDSRRDEQGRALCT
EQRRARAEEMAGAMSMFTSGFEGELFNRPGTPWPEADVTLIDLGTLAREGYSAQMALAMVSLVNTINNMA
ERDQFDVREINFVVDEAHVLTTNPLLSPYMTKVVKMWRKLGAWLWLATQNLADYPDTAEKMLNMAEWWLC
LTMPPDEVEQIARFKKLSEEQKSVLLSASKLPGCYTEGVVLSKKVEALFRVVPPSVYLALGMTEKEEKAE
RRAIMKTLHCSELDAAFVVARRLDRARGLISGEVADGRDEDLLSMQECRL
 
Nucleotide Sequence: 2883 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1256643-1259525 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
GTGATGTGGTCGCTGTTGAATAAAGTCCGCTTGCGTAAATGGGATAATCTATCGGAAGTTTTGGGTGAAA
CTGAGGTCATACTACCGTCGTCTTCTACCGTTGTTGGGCGTGAACCTTTGAGGCGTCCCGGCAAAATGAC
CAGCACGGATGAAGCTGCGTTGTATGACACTTGGCCGTCTATCATTGATTACCTGCCTTGGGTCGAATAT
TTGGACGATGAGAAGTGTTTGTTGCTGGATGATGGTCTTTCAGTCGGCGCTATTTATGCTGTTTCCCCGG
TATCGACAGAAGGACGCACTACTGCCCGTCTGGAAGATATTCGTGACCAGGTAGAAGATGCGTTGCAAGA
CAGTCTGGAAGACGATGACGTATCTCCCTGGGTAGTGCAGTTTTTTTGTCAGGATGAGGATGATCCCGCG
TTATATCTGACACAACTTCGTCAGTATATTAAACCTTGGGCGCAGGGTTCAGCCTTCACTGAAGCTTGGT
TGGCTGAAACCGAACGTCATCTGAAGGGGATAGCCCGACCAGAAGGGCTGTTTAACGATTCATTGGTGAC
TGGTCAGTCCTGGCGGGGACAGCAACGTCGTACCCGGATGGTCATTTATCGTTGGGCCCCTGTCGGACAG
AAAGAAAGCTTGCTACCCATTGTGTTGCTTAATCAGGTGTGTGACCGACTGACAGCTTCGCTGGCTAGTA
CAGGTATTTTGTGCCAACGACAAAATGGTGAACAGGTTCATCACTGGTTACTGCGATTATTCAATCCTGA
TCCAGATTGGATAGACAAAGCGACGTTGTATCAGGCAGCTAGTTATGCTACCCCACAGGCTGGTGAGAGG
AAGCCAGATAATGATTTCACGGAAACCTTGTGGTTTACCCCGCCACGTTCTGACGTGAAAAACGGTGTAT
GGTGGTTTGATAATATTGCTCACCGAGCGGTACCGGTTGAACGGCTGCGTCGTCCACCAGAGCCGGGAAC
GCTGACCGGTGAAATGGTCAGAGGGGAGAATATCAATGCACTGATGGACTTATTACCCTCAGGAACTATT
GTTTCGCTGACTGTGGTCGCACAAGCACAAGACACGCTAGAACAGGATTTCGACCGGTTGTCAAAAAATG
CCGTGGGAGAAAATACTGAATCAGGGAGAGTACGTTCAGACGTAAAAGAAGCTAAGGCACATCTGGGGCT
GAGACATAAACTGTGCCGTTCTGCACTGACCTTTCTGTTACAGGGGGCTGATGTTGACGATTTGAACCGT
CGGCATCAGCAACTGGCCGCAACCCTGTTGGTATCGGGGTTGCAGCCGGTCAAACCCGAATGCGACGTCG
CGCCGTTAAACGGTTATCTGCGTGCCTTACCGATGTGTTTTAACCCGCAACGAGACAAACATCACTGGTA
TACCCGGTTGACTTGGATGCAGCATGTGGCTGGGTTGTTGCCGGTGACAGGGCGGGCGACCGGCACAGGC
AACCCGGGTCTTAGCTTTTTTAACCGGGGCGGTGATGTGCTGACATTTGATCCGCAAAATAAACATGACC
GTACCCAGAATGCGCATCTGTTGCTGTTCGGGCCGACCGGTGCGGGGAAGTCGGCTACGCTCTGTGCGAG
TTTATCGCAGTTGATGGCGGTGCACTGTCCCCGATTATTTGTGGCGGAAGCGGGCAACAGTTTTGGGCTG
TTTGCCGATTACTGTCAACGCCTGGGGCTGAGTGTCAACAAAATCAGCATTAAACCAGGTTGTGGTGTCA
GTCTGGCGCTGTTTGCCGATGCCCACCAATTGCTTCAAGTGGCATCTTCTCAGTTGGATTTGGCGGGTGA
AAGGTCGGCAGAGGAAACCGCAGATGACGAGGCCGATGAGCAGCGCGATATCCTGGGAGAAATAGAACTT
GCGGCGCGCATGATGATCACCGGTGGGGAGAAGAAAGAGGAAGAACGTCTGACGCGGGCGGATCGGGGCA
TGATACGTGAAGCCATCATGATAGCGGCGAGAGCCAGCTTTGATGACGGCCGACAGATGATTGCGGAAGA
TTTGCAAAATGCATTGTCTGTGATTGCCCGGGACAGCCGGCGGGATGAACAGGGGAGAGCATTGTGTACC
GAACAGCGTCGGGCCCGTGCTGAAGAGATGGCGGGGGCGATGTCAATGTTCACCAGTGGTTTTGAGGGGG
AATTGTTTAATCGTCCGGGAACACCTTGGCCAGAAGCCGATGTAACGCTAATTGATCTCGGTACGCTGGC
GCGTGAAGGATATAGTGCGCAGATGGCCTTGGCGATGGTGTCTCTGGTCAATACCATCAACAATATGGCG
GAACGTGATCAATTTGATGTAAGGGAAATTAATTTTGTTGTGGATGAGGCGCATGTTCTGACCACTAATC
CGTTATTGTCACCTTATATGACCAAAGTGGTCAAGATGTGGCGAAAATTAGGGGCCTGGTTGTGGCTGGC
TACTCAGAATTTGGCGGACTATCCGGATACGGCTGAGAAAATGCTCAATATGGCGGAGTGGTGGTTGTGT
TTGACAATGCCGCCGGATGAAGTCGAACAGATAGCGCGTTTTAAAAAGCTGTCTGAAGAACAAAAATCGG
TGTTGCTATCAGCCAGCAAACTCCCGGGTTGTTACACCGAAGGCGTGGTGTTGTCGAAAAAAGTGGAGGC
GTTATTTCGGGTGGTGCCGCCCAGTGTGTATCTGGCGCTGGGCATGACGGAGAAAGAGGAAAAGGCAGAG
CGCAGGGCGATTATGAAAACGCTTCATTGCAGCGAATTAGATGCTGCCTTTGTTGTGGCGCGAAGGCTGG
ACCGTGCCCGTGGTCTGATATCTGGGGAAGTGGCGGATGGGCGTGATGAGGATCTCTTATCCATGCAGGA
GTGCAGGCTATGA
 Primer design