SecReT4
Protein ID: 37525067
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1086
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1259522..1259932 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDQ7N7N0
KEGG IDplu:plu1086
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.3e-43, Aligned region: 20..132
Protein Sequence: 136 a.a.     [Download]
>gi|37525067|ref|NP_928411.1| hypothetical protein plu1086 [Photorhabdus luminescens subsp. laumondii TTO1]
MNIRVFWALFPLLIPVSVFASTVIYTDTSHPPLNADQNVQVVYLDKPEQLQSQLFSKLSADPQQAVKQAR
QILQSPSWHQQERYISQAYQGLLNAWTLGLKKFPAVVFDDDYVVYGTTDVRQARLLWDTYQQENQP
 
Nucleotide Sequence: 411 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1259522-1259932 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAATATCAGGGTATTCTGGGCGCTTTTCCCGTTGTTAATACCGGTATCCGTGTTTGCCAGCACAGTGA
TATATACCGACACAAGCCATCCACCGCTCAATGCTGATCAAAACGTGCAAGTTGTGTACCTAGATAAGCC
AGAGCAGTTGCAATCACAGTTATTCAGTAAGCTGTCTGCTGATCCTCAACAGGCAGTCAAACAGGCCCGT
CAGATTTTGCAGTCTCCATCGTGGCATCAACAGGAGCGATATATCAGTCAGGCTTATCAGGGGTTACTGA
ATGCTTGGACTCTGGGCCTTAAGAAGTTCCCGGCAGTGGTTTTTGATGATGATTATGTTGTGTATGGTAC
GACAGACGTTAGACAGGCCCGGTTACTTTGGGATACCTATCAGCAGGAAAACCAGCCATGA
 Primer design