SecReT4
Protein ID: 37525068
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1087
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1259929..1260927 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDQ7MB68
KEGG IDplu:plu1087
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.2e-97, Aligned region: 40..321
Protein Sequence: 332 a.a.     [Download]
>gi|37525068|ref|NP_928412.1| hypothetical protein plu1087 [Photorhabdus luminescens subsp. laumondii TTO1]
MKSLDLPSLTWHSRLKKFGMVLILTVVLAPVAVASVNTAQIVSSAASVSCISWRIKGLCYWLLCSPWGCK
VRTSIKVAHFIPQAVVSVYNAPGGNPWREMSLVSQTVDGVENAVTRALSGIAVGGGNHQLKIPGNRKNNL
HFKYADAIGHPATAMMGGKISGYACKSAATPFMPYFLSTLDSLVWRTGVPESFYPEALIPGKRELGNSFR
GNMWGNVYPRSGFVTQQDDNKAAAVVAQRVADIITRTGQGHVYQSLQGNHKQGYWPPGEVVENTVNQNHQ
WQRIAPKMSTSCAVFPDNSGEAAKDGNYVFALWQPYSCCQRRGQTFLYSTDF
 
Nucleotide Sequence: 999 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1259929-1260927 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAGTCTCTAGATTTACCGTCATTAACATGGCATTCCCGGCTGAAAAAGTTCGGTATGGTCCTGATAC
TAACGGTTGTTTTGGCGCCAGTGGCCGTTGCTAGTGTGAATACGGCTCAGATTGTGTCCAGTGCCGCGTC
GGTATCGTGCATCAGTTGGCGGATAAAAGGTCTCTGTTACTGGCTGCTGTGTTCTCCCTGGGGGTGTAAA
GTGCGTACCTCGATAAAAGTTGCGCATTTTATTCCTCAGGCCGTGGTCTCCGTCTATAACGCGCCTGGCG
GTAATCCCTGGAGAGAAATGTCTCTGGTCAGCCAGACTGTTGACGGCGTGGAAAATGCCGTAACGAGAGC
ACTTTCCGGGATAGCCGTGGGGGGCGGTAATCATCAGCTGAAAATCCCAGGCAACCGAAAAAACAATCTG
CATTTTAAATATGCCGATGCGATTGGGCATCCGGCAACTGCCATGATGGGCGGAAAAATTTCGGGGTATG
CGTGTAAAAGTGCCGCCACGCCTTTTATGCCTTACTTTTTGAGTACGCTGGACAGCCTGGTTTGGCGGAC
CGGTGTGCCAGAGTCGTTTTATCCCGAAGCGCTTATTCCAGGCAAACGTGAACTGGGTAATTCGTTTCGG
GGCAATATGTGGGGCAATGTTTATCCGCGAAGCGGGTTTGTGACACAACAGGATGATAATAAAGCGGCTG
CGGTGGTAGCGCAACGGGTAGCAGACATTATCACCCGTACTGGACAGGGGCATGTTTATCAATCCTTGCA
AGGGAACCACAAACAGGGTTACTGGCCACCGGGCGAAGTCGTTGAGAATACGGTTAACCAAAATCATCAA
TGGCAACGTATAGCGCCGAAAATGAGCACCTCTTGTGCTGTTTTTCCGGATAACAGCGGGGAAGCGGCCA
AGGACGGGAATTATGTCTTTGCATTGTGGCAACCCTACAGTTGTTGTCAGCGGCGTGGACAGACTTTTCT
TTACAGTACCGATTTTTGA
 Primer design