SecReT4
Protein ID: 37525069
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1088
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1260943..1262370 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ7N7M9
KEGG IDplu:plu1088
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 475 a.a.     [Download]
>gi|37525069|ref|NP_928413.1| hypothetical protein plu1088 [Photorhabdus luminescens subsp. laumondii TTO1]
MRQRLFLPVLIALAFMTVPVVRAAGFAIADSPIGYGKSLNGAVSDKLFYNIGGGSVISQPATRSHLQHLG
GLNLGWSSDLMCGNFDLKTTVGNQLNGLTSGFKNLMGEVIQGATGAVASLPAMVIQRANPGLYEMLTNGV
LQAGIAFDKSQLSCQNMSQRMMDFSDSSKWTKAALMEEYKTLVNTGNGDAVGTTQKMEVADGTQGSNWIG
GEKRGGKGQKAIQPIRDLAKAGFNMMNNLPANSHANVNRTQCNGAACQKFKNSEEAADAVVKVLGDRSVR
TCTDSRQCTSGDTKDQPGASVAGTGFAPMLEEATRTNIEQLMKLVSGENAPTIVNLAKLKTGSLMVTRGV
IQALKRDPDSGALVSRLASELAMADTVETALTMRRMLMTGQAEPNAAAQAQAMAESDRRIATLDREITAL
KNEMELRRAIAQNTALTTLEREQNRVEMNLQRQSTDNTDSRIHTLSVPPKGREGQ
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1260943-1262370 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAGACAACGATTATTTTTGCCTGTATTGATAGCACTGGCGTTTATGACTGTTCCTGTTGTTCGGGCGG
CAGGTTTTGCCATTGCGGACAGCCCGATAGGTTACGGGAAAAGCCTGAATGGGGCGGTATCGGATAAGTT
GTTTTACAACATAGGTGGCGGATCAGTGATATCGCAGCCGGCGACCCGCAGTCATCTGCAACATCTGGGC
GGATTAAACCTCGGTTGGAGCAGTGACCTGATGTGCGGTAACTTTGATTTGAAAACGACGGTAGGGAATC
AGCTTAATGGCCTGACTTCGGGGTTTAAAAACCTGATGGGGGAAGTGATACAAGGGGCTACTGGGGCCGT
AGCTAGTTTACCCGCAATGGTTATCCAGCGTGCTAATCCGGGATTATATGAAATGCTGACCAACGGGGTG
TTACAGGCAGGTATTGCGTTCGACAAATCACAACTGAGTTGCCAGAACATGTCACAGCGTATGATGGATT
TCTCGGATAGCAGTAAATGGACTAAAGCGGCGTTGATGGAGGAATATAAAACGTTGGTGAATACCGGTAA
TGGTGATGCGGTTGGCACGACACAAAAAATGGAGGTTGCGGACGGTACACAAGGTTCAAATTGGATTGGG
GGTGAAAAACGGGGAGGAAAAGGGCAGAAAGCGATTCAGCCCATCCGGGATCTGGCAAAAGCCGGCTTCA
ATATGATGAACAACCTGCCGGCGAATAGCCATGCCAATGTCAACCGCACACAATGTAATGGCGCTGCTTG
CCAGAAATTCAAGAACAGTGAAGAAGCCGCAGACGCGGTCGTCAAGGTGTTAGGTGATCGTTCGGTTCGT
ACCTGTACTGACAGTCGTCAGTGTACCAGTGGGGATACCAAAGACCAGCCGGGTGCAAGTGTCGCTGGGA
CGGGGTTTGCACCGATGCTGGAAGAGGCTACCAGGACCAACATTGAGCAATTGATGAAACTGGTCAGCGG
GGAAAATGCGCCTACCATAGTCAATCTGGCAAAACTCAAAACAGGTAGCTTGATGGTGACTCGCGGGGTT
ATCCAGGCTCTGAAACGTGATCCGGACAGTGGGGCTTTGGTGAGTCGGTTGGCCAGTGAGTTGGCGATGG
CCGACACCGTTGAGACTGCGCTCACTATGCGACGAATGTTGATGACCGGCCAGGCAGAACCGAATGCCGC
CGCTCAGGCGCAGGCGATGGCAGAGAGTGATCGTCGCATTGCGACACTGGACAGAGAAATTACTGCCCTG
AAGAATGAAATGGAGTTGCGCCGGGCGATTGCACAAAATACCGCCCTGACCACGCTTGAGCGCGAACAAA
ATCGAGTTGAAATGAATCTGCAACGGCAATCCACCGATAATACCGACAGTCGTATTCACACCTTGTCCGT
GCCGCCGAAAGGGCGTGAAGGGCAATAA
 Primer design