SecReT4
Protein ID: 37525071
T4SS name [ID]Tfc [746]
Gene symbol-
Locus tagplu1090
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T4SS(s) in this replicon]
Location [Strand]1262741..1264255 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDQ7N7M7
KEGG IDplu:plu1090
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.8e-125, Aligned region: 8..489
Protein Sequence: 504 a.a.     [Download]
>gi|37525071|ref|NP_928415.1| hypothetical protein plu1090 [Photorhabdus luminescens subsp. laumondii TTO1]
MTTYSYLEYFLTLLGWIVNNGLWNVLLATGLFVLPLTFKMIGIWLKVREEGEDEGNKGMLSVTRIENTLY
GAFLVMIACCVPLVNVSLSTITYDDSRAKSCGTWTPKPAETGYASVISSLDGKTAAAPVWWILVHQISKG
VTQAAIASLPCSPDLRQLRFEVQHTRINNPALAQILQDFTHGCYALALYQWKRRDEGRTLDEVVLRDIEW
LGSKTFLNSAGYYDVLQSKTPRSDFPWKPHRDDGFANTGQGGYPTCKEWWSDSQVGLEKRIMAQVEPSMW
FRLSAALKLMGKETSEYKEAVIRRLVSPESLTASQGGHVYAGYGGNADFTLMNSVGRIASLGGVSLGSLA
AFPAFDAMRQALPMVQAVILMAVTIILPLIIVFAVYEYKTVVTLTFIVFALNFLTFWWELARWLDSWLLE
ALYGSDTHSRWNMAGFQNSTDDIIMSFVMGAMFIVLPALWMGALSWAGIRVGGALENTALRHGTSEAQSS
GARMGESVSNKIMK
 
Nucleotide Sequence: 1515 bp     [Download]
>gi|37524032|ref|NC_005126.1|:1262741-1264255 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACAACTTACAGCTATCTGGAATATTTTCTGACCCTGCTGGGCTGGATAGTGAATAACGGCTTGTGGA
ATGTGCTGCTGGCCACCGGGTTATTTGTGCTGCCGTTGACATTCAAAATGATAGGTATCTGGCTGAAAGT
CCGGGAAGAAGGGGAGGATGAAGGGAATAAGGGCATGCTCTCAGTAACCCGGATTGAAAACACTTTGTAT
GGCGCTTTTCTGGTCATGATTGCTTGCTGTGTGCCGTTGGTCAATGTGAGTCTGAGTACCATTACGTATG
ATGACTCGCGGGCAAAAAGTTGTGGTACTTGGACACCGAAACCGGCTGAAACGGGTTATGCGTCCGTGAT
ATCGTCGCTTGACGGTAAAACGGCGGCGGCTCCGGTTTGGTGGATACTGGTTCATCAGATTTCCAAAGGG
GTCACTCAGGCTGCAATAGCTTCTCTTCCCTGCAGTCCCGACTTGAGGCAACTGCGTTTTGAGGTCCAGC
ATACGCGGATTAATAATCCGGCACTGGCTCAGATATTACAGGATTTCACCCATGGCTGTTATGCGCTGGC
ATTGTATCAGTGGAAACGCCGGGACGAGGGAAGAACCCTGGATGAAGTGGTATTACGGGATATTGAATGG
TTAGGGTCAAAAACGTTTCTGAATAGTGCGGGTTATTATGATGTACTTCAGTCAAAAACGCCTCGTTCGG
ATTTTCCCTGGAAACCGCACCGTGATGATGGTTTTGCTAATACGGGACAGGGGGGATATCCGACCTGCAA
AGAATGGTGGTCAGACAGTCAAGTAGGATTGGAAAAACGGATCATGGCGCAGGTTGAACCAAGCATGTGG
TTTCGGCTATCTGCGGCATTGAAACTGATGGGCAAAGAGACGTCAGAATACAAAGAAGCGGTGATACGGC
GTCTGGTGAGCCCGGAAAGCTTGACCGCATCTCAAGGGGGACATGTCTATGCCGGTTACGGCGGTAACGC
GGATTTTACCCTGATGAATTCGGTGGGCCGGATAGCCTCATTGGGCGGGGTGTCGTTGGGGAGTCTGGCG
GCATTTCCGGCGTTTGATGCAATGCGCCAGGCATTACCAATGGTACAGGCTGTTATACTGATGGCGGTGA
CTATCATATTGCCCCTGATTATCGTATTTGCTGTCTACGAATATAAAACGGTCGTTACGCTGACTTTTAT
TGTGTTTGCGCTGAATTTTTTGACCTTCTGGTGGGAATTGGCACGCTGGTTGGACAGCTGGTTACTGGAG
GCATTGTATGGTTCGGATACGCACAGCCGCTGGAATATGGCTGGTTTTCAGAATAGCACAGACGATATCA
TTATGAGTTTTGTGATGGGAGCGATGTTTATTGTGCTGCCGGCATTGTGGATGGGAGCGTTGTCGTGGGC
GGGTATCAGAGTTGGTGGTGCATTAGAAAACACAGCGTTGCGACATGGGACTTCTGAAGCTCAATCTAGT
GGTGCCAGAATGGGAGAGTCGGTGTCAAACAAAATCATGAAATAG
 Primer design