SecReT4
Protein ID: 37595826
T4SS name [ID]Tra_F [518]
Gene symbol-
Locus tagVVP05
StrainVibrio vulnificus YJ016
Repliconplasmid pYJ016 [GenBank: NC_005128] [Browse all T4SS(s) in this replicon]
Location [Strand]2487..2789 [+]
Productputative conjugative transfer protein TraL
Component typeTraL_F
UniProt IDQ7MBN8
KEGG IDvvy:VVP05
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.5e-31, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|37595826|ref|NP_932205.1| putative conjugative transfer protein TraL [Vibrio vulnificus YJ016]
MEDPHQFFSIPKHMNKGRRLLGFPADEIAPALIIFGLSFWLKHEMIGLALSLGWFGGLRYIKAQYGDNII
ILSLYWWGASFVSPTFFKRTPSACRRYWIF
 
Nucleotide Sequence: 303 bp     [Download]
>gi|37595821|ref|NC_005128.1|:2487-2789 Vibrio vulnificus YJ016 plasmid pYJ016, complete sequence
ATGGAAGACCCTCATCAGTTTTTCTCCATCCCCAAACACATGAATAAGGGACGCCGGTTACTCGGCTTCC
CAGCCGATGAAATCGCACCGGCTTTGATCATCTTCGGGCTCTCATTTTGGCTCAAACACGAGATGATAGG
GCTCGCTTTATCACTAGGCTGGTTTGGGGGGCTACGCTACATCAAAGCGCAATACGGTGACAACATCATC
ATTTTGTCCCTTTATTGGTGGGGTGCTTCCTTTGTCAGCCCCACTTTCTTTAAACGCACCCCCTCCGCTT
GTCGGAGGTATTGGATTTTTTAA
 Primer design