SecReT4
Protein ID: 37595837
T4SS name [ID]Tra_F [518]
Gene symbol-
Locus tagVVP16
StrainVibrio vulnificus YJ016
Repliconplasmid pYJ016 [GenBank: NC_005128] [Browse all T4SS(s) in this replicon]
Location [Strand]13013..13879 [+]
Productputative conjugative transfer protein TraF
Component typeTraF_F
UniProt IDQ7MBM7
KEGG IDvvy:VVP16
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.7e-67, Aligned region: 57..277
Protein Sequence: 288 a.a.     [Download]
>gi|37595837|ref|NP_932216.1| putative conjugative transfer protein TraF [Vibrio vulnificus YJ016]
MKSRSDFKAQRAINPHAESLRLIQLRFMMMKKRLLYVIPLVLLVQIHPTLANETPPGWRWYNEPKPALQA
PKVEPLPSNTQTTISSPKTLSATEQMDWFHTMHKEAQNDAAIHPKDKEKLARFLALNRFITDQTDQLGMT
FKALLLEKPELSYTKEHPTEQAARQVYLDLENQKKTDAVEKMKQEGWGFFFVYDGKDKLSQQLAPSIQAF
ADQYHFELLGISNDETFITNITVNRHNQGKISVPFTPALILVHPSTGEMKPLAYGWISQNELLGRFYNVA
TNFEQSDF
 
Nucleotide Sequence: 867 bp     [Download]
>gi|37595821|ref|NC_005128.1|:13013-13879 Vibrio vulnificus YJ016 plasmid pYJ016, complete sequence
ATGAAATCAAGAAGCGACTTCAAAGCGCAACGGGCAATTAACCCTCACGCTGAATCACTTCGCCTCATAC
AACTAAGGTTTATGATGATGAAAAAAAGACTGCTTTACGTCATTCCCCTAGTGCTGCTTGTTCAAATCCA
TCCCACCTTGGCTAATGAAACACCACCAGGGTGGCGATGGTACAACGAGCCGAAACCCGCACTTCAAGCG
CCTAAAGTCGAGCCACTGCCAAGCAACACACAAACCACCATATCAAGCCCCAAAACCTTGTCAGCGACCG
AACAAATGGATTGGTTCCACACCATGCACAAGGAGGCGCAAAACGACGCCGCCATCCATCCGAAAGACAA
AGAAAAATTGGCCAGGTTCCTAGCGCTTAATCGATTTATTACCGACCAAACCGATCAGCTAGGCATGACC
TTTAAGGCTTTACTACTGGAAAAACCGGAGCTCTCTTACACCAAAGAGCACCCGACCGAGCAAGCGGCAA
GACAGGTATATCTCGATCTCGAAAACCAAAAGAAAACCGATGCAGTTGAAAAGATGAAGCAAGAAGGCTG
GGGCTTTTTCTTTGTCTATGACGGCAAAGACAAGCTTAGCCAGCAACTTGCCCCATCCATTCAAGCATTT
GCTGACCAATACCACTTTGAACTTCTTGGGATCAGCAATGATGAAACTTTCATCACGAACATCACCGTAA
ACCGCCACAACCAAGGCAAGATTTCGGTGCCGTTTACCCCCGCATTGATTTTAGTACACCCAAGCACTGG
AGAGATGAAGCCACTGGCGTATGGCTGGATAAGCCAAAACGAGCTACTTGGGCGTTTTTACAACGTCGCC
ACCAACTTTGAACAATCCGATTTTTAG
 Primer design