SecReT4
Protein ID: 378976055
T4SS name [ID]Tra_F [811]
Gene symbol-
Locus tagKPHS_p200700
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconplasmid pKPHS2 [GenBank: NC_016846] [Browse all T4SS(s) in this replicon]
Location [Strand]45949..46674 [-]
Producttype-F conjugative transfer system pilin acetylase TraX
Component typeTraX_F
UniProt IDG8XCD5
KEGG IDkpm:KPHS_p200700
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 3e-51, Aligned region: 25..239
Protein Sequence: 241 a.a.     [Download]
>gi|378976055|ref|YP_005229686.1| type-F conjugative transfer system pilin acetylase TraX [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MRAQHTFPGATDSWLQRLLTWTPGQTDMIKTVALVLMVTDHTGLLLAGNNEVMRLLGRGCFPLFGLAWGM
NLARHAEIRQSQLNNLWGWALVAQVSFMLIGYSWYTGNILFAFAVTGQVLRWVSQPSWYYTLLAAGLLVT
WIPLSTGSYGMAGVGMLTASWLLCRAQHAPERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSS
AGERVKRFWPRQFFVMFYAVHLAVLGIVVSM
 
Nucleotide Sequence: 726 bp     [Download]
>gi|378975985|ref|NC_016846.1|:c46674-45949 Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS2, complete sequence
ATGAGAGCACAACACACATTTCCAGGCGCGACAGACAGCTGGCTTCAGCGCCTGCTGACCTGGACACCGG
GACAAACGGATATGATTAAAACGGTCGCACTGGTACTGATGGTGACTGACCACACCGGCTTACTGCTGGC
CGGAAACAATGAAGTGATGCGCCTGCTGGGACGTGGTTGTTTTCCGCTGTTCGGTCTGGCATGGGGAATG
AATCTGGCACGGCACGCGGAAATACGCCAGTCTCAACTGAACAACCTGTGGGGCTGGGCGCTGGTCGCCC
AGGTGTCGTTTATGCTCATCGGGTACTCGTGGTATACCGGGAATATTCTGTTTGCCTTTGCCGTTACGGG
CCAGGTCCTGCGGTGGGTCAGCCAGCCGTCCTGGTATTACACCCTCCTGGCGGCTGGACTGCTGGTCACC
TGGATACCCCTGTCAACCGGCAGCTACGGCATGGCCGGAGTGGGCATGCTCACCGCCAGCTGGCTGCTTT
GTCGCGCACAGCATGCACCGGAACGGCTGGGATACGGGGTGTTGTGGGCCCTCATGGTGTTGCTGATGAA
TATGCATGACGTGAGTGAATCAGTGGCCGGGCTGGCGATTGCGCTGCTGACGCTGATGGTGTGCTCATCT
GCCGGAGAACGTGTGAAACGCTTCTGGCCGCGGCAGTTCTTCGTGATGTTCTATGCCGTGCACCTGGCGG
TACTGGGTATTGTCGTCTCAATGTGA
 Primer design