SecReT4
Protein ID: 378976065
T4SS name [ID]Tra_F [811]
Gene symbol-
Locus tagKPHS_p200800
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconplasmid pKPHS2 [GenBank: NC_016846] [Browse all T4SS(s) in this replicon]
Location [Strand]61977..62216 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDG8XCE5
KEGG IDkpm:KPHS_p200800
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 6.8e-35, Aligned region: 1..71
Protein Sequence: 79 a.a.     [Download]
>gi|378976065|ref|YP_005229696.1| conjugal transfer pilin chaperone TraQ [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MRNIRFPDLDITGMWVLAVGVFFHLIARLVRKQPELAVQAGEIFGLGMVVFGGYRILNALIAEAEKEEKA
CEKQPDEPR
 
Nucleotide Sequence: 240 bp     [Download]
>gi|378975985|ref|NC_016846.1|:c62216-61977 Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS2, complete sequence
ATGCGAAATATTCGTTTTCCGGATTTAGATATCACCGGGATGTGGGTGCTGGCCGTGGGCGTGTTTTTCC
ACCTGATAGCCCGGCTTGTCAGAAAACAGCCTGAGCTGGCCGTCCAGGCCGGGGAAATCTTCGGGCTGGG
TATGGTGGTGTTCGGGGGATACCGCATTCTAAACGCCCTGATTGCTGAAGCCGAAAAAGAGGAGAAAGCC
TGTGAAAAACAGCCTGATGAACCTCGCTAA
 Primer design