SecReT4
Protein ID: 378976066
T4SS name [ID]Tra_F [811]
Gene symbol-
Locus tagKPHS_p200810
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconplasmid pKPHS2 [GenBank: NC_016846] [Browse all T4SS(s) in this replicon]
Location [Strand]62227..62979 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDG8XCE6
KEGG IDkpm:KPHS_p200810
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.4e-77, Aligned region: 26..240
Protein Sequence: 250 a.a.     [Download]
>gi|378976066|ref|YP_005229697.1| conjugal pilus assembly protein TraF [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLATLQAATKRSLY
EAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKKAMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAI
STLAQHYGVMFFYRGREAIDGQLVQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFP
AMMLVNPKSGQVKPLSYGFISQDDLAKQFLYVSSDFKPNF
 
Nucleotide Sequence: 753 bp     [Download]
>gi|378975985|ref|NC_016846.1|:c62979-62227 Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS2, complete sequence
ATGCGAACAATACATGCCGCCATGCTGGCGGGGTGCCTTTGCTGCGCCCTGATGCCGGCTTTCGCCAAAG
ACGCGGGCTGGCAGTGGTACAACGAGAAACTGAAGCCCCGTGATGAGGACAGGAAAGCCGTACCAGCGGC
ACCACCGCCGCAAATGGATATTCTGGAGAAACTCGCCACACTCCAGGCGGCCACCAAACGGTCGTTGTAC
GAAGCCATTCTGTATCCATCGTCTGAAAACTTCGTGAAGTATTTCCGGCTGCAGAACTACTGGACGCAGC
AGGCAGGTTTGTTCTCGATGAGTGCGAAGAAAGCCATGCTGGAAAACCCCGAACTCGATTACAACCTGCA
GTACAGCCACTACAACGGCACGGTAAAAAACCAGCTCGCTGCCGACTATGCCGAACAGCGACAGGCTATC
TCCACCCTCGCACAGCACTACGGCGTGATGTTCTTCTACCGGGGCCGGGAAGCGATCGATGGCCAGCTGG
TCCAGGTGATTAAAAATTTTCGCGAAACCTATGGCCTGAGCGTGATACCGGTGTCGGTTGACGGAGTGAT
TAACCCCATGCTGCCCGACAGCCGGACGGACCAGGGCCAGGCAGAGCAGCTTGGCGTGAAGTTCTTCCCC
GCGATGATGCTGGTTAACCCTAAAAGTGGCCAGGTGAAGCCTCTCAGTTACGGCTTTATCAGTCAGGACG
ACCTGGCGAAACAGTTCCTCTATGTCTCCAGCGACTTTAAACCGAATTTCTAA
 Primer design