SecReT4
Protein ID: 378976087
T4SS name [ID]Tra_F [811]
Gene symbol-
Locus tagKPHS_p201020
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconplasmid pKPHS2 [GenBank: NC_016846] [Browse all T4SS(s) in this replicon]
Location [Strand]77165..77470 [-]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDG8XCG7
KEGG IDkpm:KPHS_p201020
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.2e-38, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|378976087|ref|YP_005229718.1| conjugal transfer pilus assembly protein TraL [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKFIFGIASAVLVFWGIKKLKKGRGSSW
LRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>gi|378975985|ref|NC_016846.1|:c77470-77165 Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS2, complete sequence
ATGACGGGAGACGAATTAAAGCGATACCGTTTCCCGGAAACACTGACTAACCAGTCCCGCTGGTTTGGCT
TATATCTCGATGAACTTATCCCGGCCGTGATTTGTCTCGGCTGGGGTTTCTGGACCAGCAAGTTCATTTT
TGGCATAGCTTCAGCGGTACTGGTTTTCTGGGGTATCAAGAAACTGAAAAAAGGGCGGGGCAGTTCCTGG
CTACGCGACCTGATTTACTGGTATCTGCCAACCTCCCTTCTTAAAGGTTTCTTTCATGATGTTCCGGACT
CCTGTTTCCGGCAGTGGATTAAATAA
 Primer design