SecReT4
Protein ID: 378979641
T4SS name [ID]VirB [809]
Gene symbol-
Locus tagKPHS_34820
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]3474368..3475051 [+]
Producttype IV secretion system VirB8 component
Component typeVirB8
UniProt IDG8VYZ4
KEGG IDkpm:KPHS_34820
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.2e-51, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|378979641|ref|YP_005227782.1| type IV secretion system VirB8 component [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSEQKLIAESRTFEQQMIERDKRATKAGFVVGGVGLLIAVLALVAVVVMLPLKQTDVELYTVDNHTGRVE
HVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQVNDDYLALYAGKNAPDKVYK
NGAHTVKVEILSNQITDATAPDRVATIRYKKIIRRLADNSTRNEYWDARFTFHSDPDKEMSDAEREINYF
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|378976159|ref|NC_016845.1|:3474368-3475051 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAGTGAACAGAAATTAATAGCTGAATCCCGCACTTTTGAGCAGCAAATGATTGAGCGGGATAAACGCG
CCACAAAAGCCGGTTTTGTTGTTGGCGGTGTGGGTCTGCTGATTGCGGTACTGGCGCTCGTCGCCGTGGT
CGTGATGTTGCCGCTGAAACAGACGGACGTTGAGCTGTATACCGTGGATAACCACACTGGACGGGTGGAA
CACGTTACCCGGACATCGAAAACCAGCCTGACTGCAACAGAAGCCTATCAAAAGGCGATGGCCGCAAACT
ACGTCAAAGTGCGTGAGCGGTATGTCTATCCCTCTTTGCAGGACGACTACGAGACGGTACAGGTCTACAA
CGCTCCCCAGGTAAACGATGACTACCTGGCGCTTTACGCCGGGAAAAACGCCCCGGACAAGGTTTATAAG
AACGGGGCGCACACCGTGAAAGTGGAGATCTTGTCCAACCAGATCACCGATGCGACAGCCCCTGATAGGG
TCGCCACCATCCGCTACAAGAAGATTATCCGCCGTCTGGCTGATAACAGCACCCGCAACGAATATTGGGA
TGCCCGGTTCACGTTCCATTCTGACCCTGACAAGGAAATGAGCGATGCGGAACGCGAGATCAACTACTTC
GGCTTTACCGTCACCAGTTGGCAGACCGACCGCGAAATCCGGGGAGGTGAATGA
 Primer design