SecReT4
Protein ID: 378979644
T4SS name [ID]VirB [809]
Gene symbol-
Locus tagKPHS_34850
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]3477240..3478265 [+]
Producttype IV secretory pathway VirB11 component
Component typeVirB11
UniProt IDG8VYZ7
KEGG IDkpm:KPHS_34850
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.7e-46, Aligned region: 18..279
Protein Sequence: 341 a.a.     [Download]
>gi|378979644|ref|YP_005227785.1| type IV secretory pathway VirB11 component [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGVWEQHAVPLSYEDCYNFARCLAKHHGDN
IEDIKPGLSATLESGERCQVIVPPACERDTVSITIRKPSKVQIPHQSYIDAGFYNRVTGEEKTETHDEEL
IALYNTKNIPLFMEKCVEYGKTLAVAGETSTGKTTYMKMLIGYIPVHLRISTIEDNPEITFFIHKNYVHL
FYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDG
FITRCYENPQCAQLPYTFMLRKVLDSLDVIVSIDLDGNVRRMNDIYFRPIHRNQYFEEMKA
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|378976159|ref|NC_016845.1|:3477240-3478265 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGACCGCTAAGAATATTTCCCTCGACCGCTATAAACAGCGTTTCTTTGGCGACTTTCTGGAGCTTCCCG
GCCTGACGGAGATCGCCGTCAACCGTCCAGGTGAGCTGTATACCAAAATCAACGGCGTATGGGAGCAGCA
CGCCGTTCCTTTGTCCTATGAGGATTGCTACAACTTTGCCCGGTGCCTGGCAAAGCACCACGGCGACAAT
ATCGAAGATATTAAGCCGGGGCTGTCAGCCACGCTGGAATCTGGCGAACGGTGCCAGGTGATTGTTCCCC
CGGCCTGTGAGCGCGATACGGTGTCTATCACCATCCGTAAGCCATCAAAGGTACAAATCCCGCATCAGTC
GTATATCGATGCGGGATTTTATAACCGGGTAACAGGCGAGGAAAAAACGGAGACGCACGACGAGGAATTA
ATTGCATTGTACAATACAAAAAATATTCCTCTGTTTATGGAGAAATGCGTCGAGTACGGTAAAACTCTCG
CGGTCGCCGGGGAAACAAGTACCGGGAAAACCACCTATATGAAAATGTTGATAGGGTACATTCCTGTACA
TCTTCGGATATCAACCATTGAGGACAACCCGGAAATCACGTTCTTTATCCATAAAAACTACGTCCATCTT
TTTTATCCGTCAGAATCATCAGATGAAAAAGGTTCTATCGTTACCCCGGCGAGCCTTTTACGCTGGAATT
ACCGTATGAACCCTGACCGCATTTTATTAACAGAGGTTCGCGGTGCGGAAGCCTGGGACTTCCTTAAAAT
AACAGGTTCCGGCCATGAAGGGAGTATGACCTCCATTCATGCAGGATCAGCGAAAGAAGCTATAGATGGG
TTTATTACCCGTTGCTATGAAAATCCACAGTGCGCCCAGCTCCCCTATACATTTATGTTACGTAAGGTTC
TGGATAGCCTGGACGTGATTGTGAGCATTGATTTAGACGGAAATGTCCGCCGTATGAATGACATTTATTT
TCGTCCAATTCATCGAAACCAGTATTTTGAGGAAATGAAAGCATGA
 Primer design