SecReT4
Protein ID: 378979646
T4SS name [ID]VirB [809]
Gene symbol-
Locus tagKPHS_34870
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]3480058..3481917 [+]
Productputative MobB mobilization protein
Component typeVirD4
UniProt IDG8VYZ9
KEGG IDkpm:KPHS_34870
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.2e-05, Aligned region: 194..266
Protein Sequence: 619 a.a.     [Download]
>gi|378979646|ref|YP_005227787.1| putative MobB mobilization protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MILNKLAASLSPIVNGMLALLAFVQQQQLVLALLAGLTMPFFASMKSDERQKAPLWKKLIIAFSLLCFLS
GTLAPVVIGPFQWLYKIRPSSDNTVLAWSVRIAFTVTGVIFHIMLRRIFTPELDKIKKRLVKKTTLEREL
RTDVRTVKSLLPETLHYDPLDYIDLNKGIFTGMDRKNEPMYLPLKDWQKQHADIIGTTGAGKGVAAGILL
YQSIIAGEGVFVMDPKDDEWAPHLYRKACEDAGKPFALIDLRKQQYQLNLIEDITPDELEELFVAGFSLA
EKGQESDFYRIDDRKAARMAAQFVSDNPSATLRDIYNGDYVQGIAEKIKAFFGKIEELALLNAINSPEGF
SLKHIFDEGGCCYVVGSMRNSKIITAQRMLLVRLYQLAERRDRVTDVPRPIAVYLSELKYHLSRPALEGL
GAARDKGVHIIMDHQSIADLKDCPADLKGDAVVGAVVENAKFKLVYRVMDPDTAGWVARMSGTILVDDEL
RKAKTDNMLTETIDSERTIRQAERFFIDSNMILNLPDFVSFIFTTKTLPSASLISPIKVRKRQLKIFSVS
PDIAAAAAPVKIMLDFGEDDKPAMPDVMTTHPALFFDESEVKPAKSQSDDEEHFSPLDF
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|378976159|ref|NC_016845.1|:3480058-3481917 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGATTTTAAATAAGCTTGCCGCTTCACTGTCGCCGATAGTGAACGGGATGCTGGCGCTGCTCGCTTTTG
TGCAACAGCAACAACTGGTGCTGGCGTTATTAGCGGGGCTGACGATGCCGTTTTTTGCGTCGATGAAAAG
CGATGAACGGCAGAAAGCCCCGTTATGGAAAAAGCTGATTATCGCTTTTTCCCTGCTGTGTTTTCTCTCC
GGCACACTGGCTCCGGTCGTTATCGGACCCTTTCAGTGGTTGTATAAGATCAGACCCAGCAGTGATAATA
CGGTACTGGCTTGGTCAGTACGGATTGCATTCACTGTAACCGGGGTTATTTTTCATATTATGCTTCGCCG
GATATTCACGCCGGAACTGGACAAAATAAAGAAACGCCTTGTTAAAAAAACCACCCTTGAACGGGAATTG
CGCACCGATGTCCGCACCGTAAAGTCCCTGCTGCCCGAAACACTGCATTATGATCCGCTGGATTATATCG
ACCTGAATAAAGGCATTTTTACTGGCATGGACAGGAAGAACGAACCAATGTATCTCCCGTTAAAAGACTG
GCAGAAACAGCACGCGGATATTATTGGCACCACCGGAGCCGGTAAAGGGGTAGCTGCCGGGATATTGCTA
TATCAAAGTATTATTGCCGGTGAAGGCGTTTTTGTTATGGACCCCAAAGACGATGAATGGGCACCACACC
TTTACCGCAAAGCCTGCGAGGATGCAGGAAAACCCTTTGCCTTAATTGACCTGCGAAAACAGCAATACCA
GCTAAACCTGATTGAAGATATTACGCCAGATGAACTGGAAGAATTGTTCGTTGCCGGTTTCAGCCTGGCA
GAAAAAGGGCAGGAATCGGACTTCTATCGTATTGATGACCGAAAAGCCGCCCGTATGGCCGCGCAATTTG
TCAGTGATAACCCATCGGCAACTCTCCGTGATATTTATAACGGTGATTACGTTCAGGGTATTGCCGAAAA
AATCAAAGCGTTCTTTGGGAAGATTGAGGAACTGGCATTACTCAATGCCATTAACTCACCAGAAGGCTTT
TCGCTTAAGCACATATTTGATGAGGGCGGCTGCTGTTATGTAGTCGGCTCCATGCGAAACAGCAAAATTA
TTACCGCCCAGCGCATGCTGCTGGTTCGCCTTTACCAGTTAGCAGAAAGGCGCGACCGTGTAACAGACGT
ACCCCGCCCCATTGCTGTTTATCTTTCCGAACTGAAATACCATTTATCCAGGCCAGCGCTGGAAGGTTTA
GGCGCGGCGCGGGATAAAGGCGTACACATTATTATGGACCACCAGTCCATCGCCGATTTAAAAGACTGCC
CGGCAGATTTGAAAGGTGACGCCGTTGTCGGTGCGGTCGTTGAAAATGCCAAATTCAAACTGGTTTACCG
GGTTATGGATCCGGATACGGCAGGCTGGGTGGCAAGAATGTCAGGCACGATTCTGGTGGATGACGAACTC
CGCAAGGCTAAGACGGATAATATGCTGACAGAAACCATCGACAGTGAGCGCACAATCCGCCAGGCCGAAC
GTTTCTTTATTGACAGCAATATGATCCTGAACCTGCCCGATTTTGTCAGCTTTATCTTTACGACAAAAAC
GCTACCTTCTGCCTCCTTGATTTCACCGATAAAGGTCAGAAAGCGTCAGCTAAAAATCTTCTCGGTTTCC
CCTGATATTGCCGCAGCGGCAGCCCCGGTGAAGATCATGCTGGATTTTGGCGAGGATGATAAACCAGCCA
TGCCGGATGTGATGACAACCCATCCGGCTCTTTTCTTCGACGAAAGCGAAGTAAAACCGGCAAAGTCCCA
ATCTGATGATGAAGAACACTTCTCCCCACTGGATTTTTAA
 Primer design