SecReT4
Protein ID: 378980645
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_44860
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4515958..4516257 [+]
Producthypothetical protein
Component typeTfc20
UniProt IDG8VWC4
KEGG IDkpm:KPHS_44860
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 99 a.a.     [Download]
>gi|378980645|ref|YP_005228786.1| hypothetical protein KPHS_44860 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSEEKFNPQDIEEILSRPPSSDSHKVKKGDIPEIAKSIGIGAIEIVKALPILAFGALSISTKHTPITKAG
YRDGSEGYGYYDETGLRNRTFDPSQSDDK
 
Nucleotide Sequence: 300 bp     [Download]
>gi|378976159|ref|NC_016845.1|:4515958-4516257 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAGTGAAGAAAAGTTTAACCCGCAGGATATTGAAGAGATCCTCTCTCGCCCGCCGTCTTCCGACAGCC
ACAAAGTCAAGAAAGGCGATATTCCCGAAATCGCCAAAAGCATCGGCATTGGGGCCATAGAAATCGTCAA
AGCGCTTCCGATTCTTGCGTTCGGCGCGCTGTCTATTTCCACTAAGCACACCCCGATAACAAAAGCAGGC
TATCGGGATGGCTCGGAAGGATATGGCTATTATGATGAAACAGGTCTGAGGAATCGTACTTTTGACCCCA
GCCAATCAGACGATAAATAA
 Primer design