SecReT4
Protein ID: 378980646
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_44870
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4516301..4517830 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDG8VWC5
KEGG IDkpm:KPHS_44870
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2e-101, Aligned region: 8..485
Protein Sequence: 509 a.a.     [Download]
>gi|378980646|ref|YP_005228787.1| hypothetical protein KPHS_44870 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSADSYLEYFLILLGWILNNAIWKTLLSTGLFALPIAGKVVATWLRTREEGDDEGNKGTLALVRIEHVIY
VAFVVLMFCVTPVVNVDVNTIKFNKERSAQCGVNIPLPQKSGYATLINDFDGKTAMVPVWWYMIHSLSKG
VTHATIAGIPCGDNLRQLRFDVQHTQIKDPILLEEVQDFANQCYAKAYFRLKSTNAQLSDATINSVGWIG
SDYFLSTSGYYDYYTSTKPRSQWPYDANRDDGYPDVGRGGYPTCKQWWNTPTVGLKTRVMSSYNDITTRA
LKKKFGNEWEEIALRWVVSPKNASLSGDGETYMMGNNASAGTFSFVSSALGSLGVAAGQVVALPGFDILK
YTLPMVQALLEMALVIVIPLVLMFSVYSPKAVVTVSFAMFALMFLTFWWEFAGWLDDRLIDIVYSGLDNV
DGGNPVPFADFAGSTTDGWVMNLVMGTMYLVFPAFWIGALSWAGIKVGGEVAGSLQKGAGKAQSAGEKGG
EVASDVAGAAMTKGKSMMK
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4517830-4516301 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAGTGCCGACAGCTATCTGGAGTACTTCCTCATCCTACTGGGCTGGATCCTGAATAACGCCATCTGGA
AAACGCTGCTTTCAACCGGCCTGTTTGCGTTGCCTATTGCGGGTAAAGTGGTGGCGACCTGGTTACGAAC
TCGCGAAGAGGGGGACGATGAGGGCAATAAGGGCACGCTGGCGCTGGTGCGCATCGAGCACGTTATTTAC
GTGGCCTTCGTTGTGCTGATGTTTTGCGTGACGCCGGTCGTTAATGTGGATGTCAACACCATCAAGTTCA
ATAAGGAACGCAGCGCCCAGTGCGGCGTGAACATCCCGCTCCCCCAGAAGTCGGGCTATGCCACGCTGAT
TAATGACTTTGACGGTAAAACGGCCATGGTACCGGTGTGGTGGTACATGATCCACAGCCTGTCAAAAGGC
GTAACGCACGCGACGATCGCCGGTATTCCCTGCGGTGATAACCTGCGTCAGCTACGTTTCGACGTGCAGC
ACACGCAGATAAAGGATCCGATCCTGCTGGAAGAGGTGCAGGACTTCGCTAATCAGTGCTATGCCAAAGC
CTATTTCCGGCTGAAGTCGACCAACGCCCAGCTTTCGGACGCGACCATTAATTCCGTCGGCTGGATTGGC
TCTGACTACTTTCTTTCGACGTCAGGGTATTACGACTATTACACCTCCACCAAACCGCGTTCGCAGTGGC
CCTACGATGCGAATCGGGATGATGGTTATCCCGACGTAGGGCGGGGCGGTTACCCTACCTGTAAGCAGTG
GTGGAACACTCCGACCGTCGGTCTGAAGACGCGGGTGATGTCCAGCTACAATGACATCACGACTCGCGCG
CTAAAGAAGAAGTTTGGCAACGAGTGGGAAGAGATCGCGTTGCGCTGGGTGGTCAGCCCGAAAAATGCCT
CGCTCTCCGGCGACGGCGAAACCTATATGATGGGGAATAACGCCTCGGCGGGTACATTCAGCTTTGTGTC
CAGCGCGCTGGGAAGCCTGGGCGTCGCTGCCGGGCAGGTGGTGGCGCTGCCCGGATTCGATATTCTCAAA
TATACCCTGCCGATGGTGCAGGCGCTGCTGGAGATGGCGCTGGTGATTGTCATTCCTCTGGTGCTGATGT
TCAGCGTCTATTCGCCCAAGGCTGTGGTGACGGTGTCGTTCGCCATGTTTGCCCTGATGTTCCTGACGTT
CTGGTGGGAGTTTGCGGGCTGGCTGGATGACCGCCTGATCGACATCGTCTACAGCGGGCTGGATAATGTC
GACGGCGGGAACCCGGTGCCTTTTGCTGACTTTGCCGGTTCAACGACGGACGGCTGGGTGATGAACCTGG
TGATGGGAACGATGTATCTGGTGTTTCCGGCGTTCTGGATTGGTGCGCTGAGTTGGGCGGGAATTAAGGT
CGGTGGTGAAGTGGCGGGGTCGCTGCAAAAAGGCGCAGGTAAGGCGCAATCAGCAGGAGAAAAAGGGGGC
GAGGTTGCGTCAGACGTCGCCGGAGCTGCGATGACAAAGGGAAAATCGATGATGAAATAA
 Primer design