SecReT4
Protein ID: 378980648
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_44890
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4518171..4519592 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDG8VX51
KEGG IDkpm:KPHS_44890
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 473 a.a.     [Download]
>gi|378980648|ref|YP_005228789.1| hypothetical protein KPHS_44890 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MIRMTMFQRMFLASLVLCSASASAVDLPAFSMNSSGNDTSRQVQGGINDDLYYAIGGGTVVSNPPSGNRL
NKIGMGVGWNADLMCGNFDVKTTVKNQLNGLTSGFKDMMGDVISSATGAVASLPAMVIQRANPGLYELLT
NGTLQANAYFDKAQLNCQAMSKKLADHTLSGPWVQAAVGEEYQNALSGTSDAVKADQQLSKSTGTEGVSW
VGGKKRGGKGQAAIRPTHDIARAGYNILNKQAADSSASISESACNGALCRKYKNGDEAAQVVASVLGDRS
IRTCKSGNECASGGLENEPGTTTPGTGFTPMLDETTQKNYEVLVELVNGSLPVNAANLAKLKTGDLTVTR
GVVQALKDDPDNTALVQRLASELAMADTVATAFGMRRMLTAGQSEPHVAEQQEALTEAERRLEFLDREIV
ALKNEMELRKQISNNTIVTALSRQTQRGLENSARQKNPDADEAVQQLGTEVAP
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4519592-4518171 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGATCAGAATGACGATGTTTCAACGCATGTTTCTCGCCAGCCTGGTGCTGTGCAGCGCTTCAGCCAGCG
CGGTGGATTTACCGGCGTTTTCCATGAACAGCTCAGGCAATGACACCAGTCGTCAGGTGCAGGGCGGTAT
TAACGACGATCTCTATTACGCCATCGGCGGCGGGACGGTGGTGTCCAACCCGCCCAGCGGCAACCGGCTG
AATAAAATTGGCATGGGCGTTGGCTGGAATGCCGACCTGATGTGTGGAAATTTTGACGTCAAAACCACGG
TAAAAAATCAGCTCAACGGCCTGACCAGCGGCTTTAAAGACATGATGGGGGACGTGATCAGCAGTGCGAC
CGGCGCGGTCGCCAGCCTGCCCGCGATGGTTATCCAGCGCGCCAATCCCGGCCTGTACGAGCTGTTAACC
AACGGCACGCTTCAGGCCAACGCTTACTTTGATAAGGCGCAGTTGAACTGTCAGGCCATGTCGAAGAAGC
TGGCGGATCACACCCTGTCCGGGCCGTGGGTGCAGGCCGCCGTTGGGGAGGAGTATCAGAACGCCCTGAG
TGGGACGAGCGACGCGGTGAAGGCCGATCAGCAACTGAGCAAATCAACGGGAACCGAGGGCGTCTCCTGG
GTCGGCGGCAAAAAGCGTGGCGGTAAAGGGCAGGCCGCGATCCGGCCAACGCACGATATTGCCAGGGCCG
GGTACAACATCCTCAATAAGCAGGCGGCGGACAGCAGCGCATCCATTAGTGAAAGCGCCTGTAACGGCGC
GCTGTGCCGCAAATATAAAAACGGCGATGAAGCGGCTCAGGTGGTCGCCAGCGTGTTAGGCGATCGCTCT
ATTCGCACCTGTAAATCCGGCAATGAGTGCGCCAGCGGCGGGCTGGAGAACGAACCCGGCACCACGACGC
CGGGAACCGGCTTCACGCCGATGCTCGATGAGACAACCCAGAAGAATTACGAGGTTCTGGTCGAGCTGGT
GAACGGTTCATTGCCGGTCAATGCGGCTAATCTGGCGAAGCTGAAAACCGGCGACCTCACGGTGACGCGC
GGCGTTGTTCAGGCGCTAAAGGATGACCCGGACAACACCGCTCTGGTGCAACGTCTGGCAAGCGAGCTGG
CGATGGCGGATACGGTGGCGACCGCGTTCGGTATGCGCCGGATGCTGACCGCCGGGCAGTCGGAACCTCA
CGTTGCGGAGCAGCAGGAAGCGCTGACGGAAGCCGAGCGCCGGCTGGAGTTTCTGGACCGGGAAATTGTG
GCGCTGAAGAACGAGATGGAGCTGCGCAAGCAGATCAGCAACAACACCATTGTTACAGCGCTGTCGCGAC
AGACCCAGCGCGGCCTTGAGAACAGCGCCCGCCAAAAAAATCCCGATGCCGATGAAGCCGTACAGCAGCT
GGGGACGGAGGTGGCGCCATGA
 Primer design