SecReT4
Protein ID: 378980649
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_44900
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4519608..4520549 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDG8VX52
KEGG IDkpm:KPHS_44900
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.1e-91, Aligned region: 34..298
Protein Sequence: 313 a.a.     [Download]
>gi|378980649|ref|YP_005228790.1| hypothetical protein KPHS_44900 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MKHRFAYPLAALLMAGSAVPASASLTTPQLVASAACPDCIDYRVVGVCYWLLCTPFGCSVKTSVKVRHFI
PQVVVSAYRQPGDNPWREVAMLSRSALGGLADGGGENQQKRGQRKDNVRYRSVDAIGHPAASLIGQQTSG
YSCKGAATAWQPYFLSNLDALMWRTGLPESVYPEALTPGRREIGATTAGNMWGNVYPRSGFVTQTDDYKA
AAVTAQRAADIITRPGQIHVYRTLKANASAGYWPPDPVTENTGTRNHKWQRLAPKVSMSCAAFPDRAFSY
AEDGNYAWALWQPFACCKKRGQTFLFSTDIGGY
 
Nucleotide Sequence: 942 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4520549-4519608 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAAGCATCGGTTTGCTTATCCACTGGCCGCGCTGCTGATGGCGGGAAGCGCCGTACCCGCATCCGCCT
CGCTGACCACGCCCCAACTTGTCGCCAGCGCCGCGTGCCCGGACTGCATTGACTATCGGGTAGTGGGTGT
TTGTTACTGGCTGCTGTGTACCCCGTTTGGTTGCAGCGTCAAGACGTCGGTAAAAGTACGTCACTTTATC
CCGCAGGTGGTGGTGTCGGCCTATCGCCAGCCGGGCGATAACCCGTGGCGTGAGGTCGCGATGCTGAGCC
GCAGCGCATTAGGCGGGCTGGCTGACGGTGGCGGTGAGAATCAGCAAAAGCGCGGCCAGCGTAAAGACAA
TGTGCGCTACCGCAGCGTGGACGCGATCGGCCATCCCGCCGCCAGCCTTATCGGTCAGCAGACCTCCGGC
TATTCCTGCAAGGGAGCCGCCACCGCTTGGCAGCCGTATTTCCTGAGCAATCTGGATGCGCTGATGTGGC
GCACCGGTTTGCCGGAAAGTGTTTACCCGGAGGCGCTCACCCCGGGGCGGCGGGAAATCGGCGCAACCAC
TGCCGGGAACATGTGGGGCAACGTCTATCCCCGTTCCGGCTTTGTCACACAGACGGACGACTATAAGGCC
GCTGCCGTGACGGCTCAACGTGCGGCAGACATCATTACCCGCCCCGGGCAGATCCACGTTTATCGGACGC
TGAAGGCCAACGCTTCCGCTGGCTACTGGCCGCCCGATCCGGTGACGGAAAACACCGGCACCCGCAACCA
TAAGTGGCAGCGCCTCGCTCCGAAGGTGTCCATGTCCTGCGCCGCGTTTCCCGACCGCGCGTTTTCCTAT
GCCGAAGACGGCAACTATGCTTGGGCGCTGTGGCAGCCCTTTGCCTGCTGCAAAAAGCGCGGCCAGACGT
TTCTTTTCAGCACCGATATTGGTGGCTATTAA
 Primer design