SecReT4
Protein ID: 378980650
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_44910
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4520546..4520941 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDG8VX53
KEGG IDkpm:KPHS_44910
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 5.4e-35, Aligned region: 19..125
Protein Sequence: 131 a.a.     [Download]
>gi|378980650|ref|YP_005228791.1| hypothetical protein KPHS_44910 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MQRLLIIIASLVLAGQACADVVLYTDRHHPPLDNDPQVTVVWLDAPDTAQQQIFGNLALEPDKAERQAKV
LPQSPNWARQQARIVDAWQGVLKAWQLDIRKVPAVVFDDRDVVYGTTDIQRAAALRAGSRP
 
Nucleotide Sequence: 396 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4520941-4520546 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGCAACGACTACTCATCATAATTGCATCACTGGTGCTGGCCGGGCAGGCCTGTGCCGACGTGGTTTTGT
ACACCGACCGCCATCACCCTCCGCTAGATAACGATCCGCAGGTCACGGTGGTCTGGCTGGATGCGCCGGA
CACGGCGCAGCAGCAGATTTTCGGCAATCTGGCGCTTGAGCCCGACAAAGCGGAGCGGCAGGCAAAGGTG
TTGCCTCAGTCGCCGAACTGGGCACGTCAGCAGGCGCGGATCGTCGATGCCTGGCAGGGCGTACTGAAGG
CCTGGCAACTGGACATTCGCAAGGTGCCCGCCGTGGTGTTTGACGATCGCGATGTGGTGTACGGCACCAC
GGATATTCAGCGTGCGGCGGCGCTGCGCGCAGGGAGCAGGCCATGA
 Primer design