SecReT4
Protein ID: 378980659
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45000
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4528941..4531718 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDG8VX62
KEGG IDkpm:KPHS_45000
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2e-63, Aligned region: 46..312
AAA_10 [PF12846], Evalue: 1.3e-44, Aligned region: 505..843
FtsK_SpoIIIE [PF01580], Evalue: 5.5e-06, Aligned region: 502..535
DUF87 [PF01935], Evalue: 4.9e-05, Aligned region: 506..531
Protein Sequence: 925 a.a.     [Download]
>gi|378980659|ref|YP_005228800.1| hypothetical protein KPHS_45000 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MMFSLFTREKAAAPVPQAEEKAVLKPSLRKSGKLKISDEQARYHREPPLIDYLPWVEYLPSSQSILLDDG
VSVGAVFDVLPVGSEGRTAERLEEIRDVIEDAIQDSFDERDTCPWVIQFFCQDETDVTAYLDRLRGYIKP
WAQGSAFTEDYLREIEGHMRGIAVPQGLFIDKTVTGAPWRGQQRRTRMVVYRYVDPAQRDPYSPETALSQ
VCERLVSALNGAGVVAERQSGEQIHAWLLRWFNPDPQWVEKEVLYRTARHHDNPHNALPLMTDFSESLWF
TPPRSDAENGVWWFDEQPHRAVTIDRLRRPPAVGHLTGETRKGDNINALMDLMPEGTVMCMTIVVQAQDV
LEERFTHLAKNAIGENVESSRVREDAAIAKSFLGERHKLYHGSMTFLLTAPDLPQLQSRQRELNAVLLNA
GLQPTRGEYEVAPLNGYLRAMPMCFNPARDKHHWYTRLTFVQHLANLSPLFGRDTGTGNPGFTFFNRGGA
PLTFDPLNSNDRTKNAHMAIFGPTGSGKSATLNSLFSQLMAIHRPRLFIAEAGNSFGLFADYCGELGLTV
NKISIKPGCGISLAPFADAHKLIEQPVVPVSESELSDGIDIDDVDGEEDGDEERDILGELEIAARLMITG
GEEKEEARLERADRGMMREAILAAAQQAWDEGRQMITGDLQSAFYQFARDPARPAERQVRAQNMGESLGV
FMQGFLGELFNRPGENWPEADVTLIDLGTLAREGYEAPLAVAYISLVNTINNLAERDQFDDREIVFATDE
AHMITTNPLLAPYVVKVVKMWRKLGAWLWLATQNLDDFPNAAKKMLNMIEWWLCLVMPPEEVEQIARFKK
LTEEQKAMLLSANKAKHCYTEGVVLASRIEALFRAVPPSLYLALGMTEKEEKAQRRALMNEYGISELGAA
KRVARQMDELRGILR
 
Nucleotide Sequence: 2778 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4531718-4528941 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
GTGATGTTTAGCCTGTTTACGCGTGAAAAGGCGGCGGCACCTGTGCCGCAGGCTGAAGAGAAGGCGGTAC
TCAAACCGTCGTTGAGGAAATCGGGCAAGCTGAAAATCTCGGATGAGCAAGCGCGCTACCATCGTGAACC
GCCATTGATTGACTACTTGCCCTGGGTTGAATATCTGCCGTCCAGCCAGAGCATTTTGCTGGATGACGGC
GTGTCGGTGGGCGCGGTGTTCGACGTGCTGCCGGTCGGTTCGGAAGGGCGTACGGCGGAGCGCCTGGAGG
AGATCCGTGACGTCATTGAAGACGCCATTCAGGACAGCTTTGACGAGCGGGATACTTGCCCGTGGGTGAT
CCAGTTCTTCTGTCAGGATGAAACAGACGTCACCGCCTATCTGGACAGGCTGCGCGGTTACATCAAGCCC
TGGGCGCAGGGGAGCGCCTTCACCGAGGACTACCTGCGGGAGATTGAAGGCCACATGCGCGGGATCGCCG
TACCGCAAGGGCTGTTTATTGATAAGACCGTCACCGGCGCGCCGTGGCGTGGTCAGCAGCGGCGTACCCG
CATGGTGGTCTATCGCTATGTCGACCCCGCCCAGCGCGATCCGTATTCACCCGAAACGGCGCTGAGTCAG
GTGTGCGAGCGGCTGGTTTCCGCCCTGAACGGCGCGGGCGTGGTGGCGGAACGCCAGAGTGGGGAGCAGA
TCCACGCCTGGCTGCTGCGCTGGTTTAACCCCGACCCGCAGTGGGTGGAAAAGGAGGTGCTCTACCGCAC
CGCCCGCCATCACGACAACCCACATAACGCACTGCCGCTGATGACCGACTTCAGCGAATCCTTATGGTTT
ACGCCGCCGCGCTCGGATGCGGAAAACGGCGTCTGGTGGTTTGACGAACAGCCTCACCGGGCGGTAACTA
TCGATCGCCTGCGTCGCCCCCCTGCGGTGGGACATCTGACCGGGGAGACCCGCAAGGGTGACAACATCAA
TGCCCTGATGGACCTCATGCCGGAAGGCACCGTGATGTGCATGACCATTGTGGTGCAGGCACAGGACGTG
CTGGAAGAGCGTTTTACCCATCTGGCAAAAAACGCGATTGGCGAAAACGTGGAATCGTCCCGGGTGCGGG
AAGATGCGGCCATTGCCAAGTCGTTTCTGGGCGAGCGGCACAAGCTCTATCACGGCAGCATGACGTTTTT
GCTAACGGCTCCGGATCTGCCGCAGCTCCAGTCGCGCCAGCGCGAGCTGAACGCAGTATTGCTGAACGCC
GGTTTACAGCCCACCCGGGGCGAATACGAGGTTGCGCCGCTGAATGGGTACCTGCGCGCCATGCCGATGT
GCTTTAACCCGGCCCGGGATAAGCACCATTGGTATACCCGCCTGACCTTTGTCCAGCATCTGGCGAACCT
GTCACCGCTGTTCGGGCGGGATACCGGCACCGGCAACCCGGGATTCACCTTCTTTAATCGCGGCGGCGCG
CCGCTCACGTTCGATCCGCTGAACAGCAATGACCGTACCAAGAACGCCCATATGGCGATTTTCGGGCCGA
CGGGCTCCGGCAAGTCGGCCACGCTCAACAGCCTGTTTTCCCAGTTAATGGCGATCCACCGGCCCCGGTT
GTTCATCGCTGAAGCCGGGAACAGCTTTGGCCTGTTTGCCGATTACTGCGGTGAGCTGGGGCTGACGGTG
AACAAAATCAGCATCAAGCCGGGCTGCGGGATTTCTCTGGCCCCGTTTGCTGATGCGCACAAGCTGATTG
AGCAGCCGGTGGTCCCCGTCAGTGAAAGCGAGCTTAGCGACGGCATTGATATTGACGACGTTGACGGTGA
AGAGGACGGCGACGAGGAGCGCGACATTCTGGGGGAGCTGGAGATCGCCGCCCGCCTGATGATCACCGGT
GGGGAGGAGAAGGAAGAGGCCAGGCTGGAACGCGCCGATCGCGGCATGATGCGTGAGGCCATTCTGGCGG
CGGCGCAACAGGCCTGGGACGAAGGCAGGCAGATGATCACCGGCGACCTTCAGTCGGCGTTTTATCAGTT
TGCCCGCGATCCCGCCCGCCCCGCCGAACGGCAGGTACGCGCTCAGAATATGGGGGAGTCGCTCGGCGTG
TTTATGCAGGGCTTTCTGGGTGAGCTGTTTAATCGCCCGGGCGAGAACTGGCCGGAAGCGGACGTGACGC
TGATTGACCTCGGCACGCTGGCGCGTGAAGGCTATGAAGCGCCGCTGGCGGTAGCCTATATTTCGCTGGT
GAACACCATCAATAATCTGGCGGAACGCGATCAGTTCGACGATCGGGAAATCGTGTTCGCCACCGATGAG
GCCCATATGATCACCACCAACCCGTTGCTGGCTCCCTACGTGGTGAAGGTGGTCAAGATGTGGCGAAAGC
TGGGAGCATGGCTTTGGCTGGCGACGCAGAACCTTGATGACTTCCCCAATGCGGCGAAAAAGATGCTCAA
CATGATCGAGTGGTGGCTGTGCCTGGTGATGCCGCCGGAAGAGGTGGAGCAGATAGCGCGCTTTAAAAAG
CTGACGGAGGAGCAGAAGGCCATGCTGCTGTCGGCCAATAAAGCGAAGCACTGCTATACCGAGGGTGTGG
TGCTCGCCAGCCGGATTGAGGCGCTGTTTCGCGCCGTGCCGCCCAGCCTGTATCTGGCGCTGGGGATGAC
GGAGAAAGAGGAGAAGGCGCAGCGCAGGGCGTTGATGAATGAATACGGTATTAGCGAGTTGGGGGCCGCG
AAGCGGGTTGCCCGGCAGATGGATGAATTGCGGGGGATCCTTCGCTAG
 Primer design