SecReT4
Protein ID: 378980660
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45010
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4531715..4532113 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDG8VX63
KEGG IDkpm:KPHS_45010
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 132 a.a.     [Download]
>gi|378980660|ref|YP_005228801.1| hypothetical protein KPHS_45010 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MMPRIYLLLAALWLAGCSTSKEQLLPPGDSTMLDLWQQKSGSPQMTAEARAVLRRDLNDVERNAQPAVAE
SYSRDANSEIQQQFPRLPNPDLVMYVFPHMTVGNVPVPGYSTVFPFYSQVQYALPGERVGAL
 
Nucleotide Sequence: 399 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4532113-4531715 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGATGCCCAGAATATATTTACTGCTGGCCGCGCTATGGCTGGCCGGATGCAGTACGTCAAAAGAGCAAT
TACTTCCCCCGGGGGATTCCACCATGCTGGATCTGTGGCAGCAAAAAAGCGGCTCGCCGCAGATGACCGC
AGAAGCGCGCGCCGTACTGCGCCGCGACCTGAATGACGTCGAGCGGAACGCGCAGCCGGCAGTGGCGGAA
AGCTACAGCCGGGATGCTAACAGCGAGATCCAGCAGCAATTTCCTCGCTTGCCCAATCCCGATCTGGTGA
TGTATGTCTTCCCACATATGACGGTAGGCAACGTGCCGGTACCGGGCTACAGCACGGTATTTCCTTTCTA
CAGCCAGGTGCAGTATGCCCTGCCGGGTGAACGAGTGGGAGCGCTGTGA
 Primer design