SecReT4
Protein ID: 378980661
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45020
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4532127..4533611 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDG8VX64
KEGG IDkpm:KPHS_45020
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 494 a.a.     [Download]
>gi|378980661|ref|YP_005228802.1| hypothetical protein KPHS_45020 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MMQVKSNTLLKMAVPACLFIAIAIGVKSCGSRSQPAATQTGDSVVADLTQEELKALGVEGDTPQDTLRTL
VGRMRTIQNKQVELDRDNKALAEENARLAQGESGLDNRISAAVAKAQKEAEQKAEGVKEEQRQLSKALDE
LKERLLNGGAGGSSAGANGDLPVGLGLGAGDEPPAPASGEGMVWIEPQDAMQMSRDGKMTLADVSASGTG
GALQFPSRFSSLEDNEITRQKAELARNAKNERGIEDAATPVYTLPENSTLVGSQAMTALLGRVPIDGKVT
DPYPFKVLIGKDNLTANGIQLPDVEGAIVSGTATGDWTLSCVRGDVQSITFVFSDGTVRTVPSPAKSTDG
SDNKNRSGGSIGWLSDEHGVPCLAGERKSNASTYLPTLFALSGATAAAEAMAEGEMTSSTEGTDVTRTLT
GDAGTYALGKAVSGGMQETTNWVRQRYGQTFDAIYVPPGLRVAVHITRQLPIDYEEQGRRVKYDAAVGPQ
QHLD
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4533611-4532127 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGATGCAGGTGAAGTCAAACACGTTGTTAAAGATGGCGGTGCCCGCCTGTCTGTTTATCGCCATTGCCA
TTGGGGTGAAGTCCTGCGGTTCACGTTCACAGCCTGCGGCGACGCAGACAGGGGATAGCGTGGTCGCGGA
TCTGACGCAGGAAGAGCTGAAGGCGTTGGGTGTGGAAGGGGATACGCCTCAGGACACGTTGCGCACGCTG
GTTGGCCGGATGCGGACGATCCAGAATAAGCAGGTCGAACTGGATCGAGACAATAAAGCGCTGGCGGAAG
AGAACGCCAGACTGGCGCAGGGGGAAAGTGGTCTGGATAACCGCATCAGTGCGGCGGTGGCAAAGGCGCA
AAAAGAGGCGGAACAAAAGGCCGAAGGGGTAAAGGAAGAGCAGCGCCAGTTGAGCAAAGCCCTCGATGAG
CTGAAGGAAAGACTGCTGAACGGCGGCGCAGGCGGTTCGTCTGCCGGGGCGAACGGCGATTTACCCGTTG
GCCTTGGGCTGGGAGCCGGAGATGAGCCGCCTGCACCGGCCAGTGGCGAGGGCATGGTCTGGATTGAGCC
GCAGGATGCGATGCAGATGAGCCGTGACGGCAAAATGACGCTGGCCGACGTTTCCGCATCAGGAACCGGC
GGCGCGCTTCAGTTCCCCAGCCGTTTCTCCAGTCTGGAGGATAACGAGATCACCCGCCAGAAGGCCGAAC
TGGCGCGTAACGCGAAAAATGAGCGCGGCATTGAGGACGCGGCGACGCCGGTGTATACGCTGCCGGAAAA
CTCAACGCTGGTAGGCAGCCAGGCCATGACGGCCTTGCTGGGGCGGGTACCGATTGACGGTAAAGTCACC
GACCCTTACCCGTTCAAAGTGCTGATCGGCAAAGATAACCTGACGGCAAACGGCATCCAGTTGCCTGACG
TGGAAGGGGCGATTGTCTCAGGAACGGCAACCGGCGACTGGACGCTCTCCTGCGTGCGGGGCGATGTGCA
AAGCATCACCTTCGTTTTCAGCGACGGTACGGTTCGTACCGTTCCCAGCCCGGCTAAATCGACCGACGGC
AGCGATAACAAAAACCGCAGCGGCGGCAGCATCGGCTGGCTGTCGGATGAGCATGGCGTTCCGTGTCTGG
CCGGTGAGCGTAAATCCAATGCCTCCACCTATTTACCGACCCTGTTTGCCCTGTCCGGCGCGACGGCAGC
GGCGGAAGCAATGGCGGAAGGGGAAATGACCTCCTCCACGGAGGGGACTGACGTAACCCGGACGTTAACG
GGAGATGCCGGAACCTATGCGCTGGGTAAGGCGGTGTCCGGCGGGATGCAGGAAACCACCAACTGGGTAC
GCCAGCGCTACGGCCAGACGTTTGACGCTATCTATGTGCCACCCGGCCTGCGCGTGGCGGTACATATCAC
CCGCCAACTGCCGATTGACTATGAAGAGCAGGGCCGCAGGGTCAAATACGATGCGGCCGTCGGCCCGCAG
CAGCATCTGGATTAA
 Primer design