SecReT4
Protein ID: 378980662
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45030
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4533608..4534453 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDG8VX65
KEGG IDkpm:KPHS_45030
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 6.8e-110, Aligned region: 4..275
Protein Sequence: 281 a.a.     [Download]
>gi|378980662|ref|YP_005228803.1| hypothetical protein KPHS_45030 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MKRLLLSLALLAPCAVQAVELMKWERIPLPVPLNVGQERIVFVDKNVRVGFPATLNGKMRIQSSGGAVYL
QAEEAFPVTRLQLQDLENGELILLDVSAQDGKAALEPVRLVYSGEVATASASHKGAVSGRDASGERENGA
AGQGEVKLSAPLPVQLTRYAAQHLYAPLRTVEAVPGISPVSLKPAVITSLLPSEPVETKTLAAWAASGYS
VVAVRLKNQSDKPVVLDPRRLQGRFYSATFQHRWLGAQGTPEDTTLLYLVFTGRPENAFLPSAVMAKKGG
R
 
Nucleotide Sequence: 846 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4534453-4533608 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAAGCGACTGTTATTAAGCCTCGCGCTGCTGGCTCCCTGCGCCGTTCAGGCCGTGGAGCTCATGAAAT
GGGAGCGCATTCCACTGCCTGTCCCGCTGAACGTCGGGCAGGAGCGGATTGTGTTTGTTGATAAGAACGT
GCGGGTAGGCTTCCCCGCAACCCTGAACGGAAAGATGCGCATCCAGAGCAGCGGCGGCGCGGTCTACCTT
CAGGCGGAGGAGGCATTCCCCGTGACCCGCTTGCAGTTGCAGGATCTGGAAAACGGCGAGCTGATCCTGC
TGGACGTCAGCGCCCAGGACGGAAAAGCCGCGCTGGAGCCGGTCAGGCTGGTTTACTCCGGGGAAGTCGC
GACGGCGAGCGCCAGCCATAAGGGAGCCGTGTCAGGGCGTGACGCCAGCGGTGAAAGGGAAAACGGCGCG
GCTGGTCAAGGCGAAGTAAAGCTCTCCGCGCCTTTACCGGTACAGCTGACGCGCTACGCGGCGCAGCATC
TGTATGCCCCGCTGCGCACGGTGGAGGCCGTGCCCGGTATTTCTCCTGTCTCCCTTAAGCCTGCCGTCAT
CACCTCTCTGCTGCCCTCGGAACCTGTCGAAACCAAAACGCTCGCCGCATGGGCCGCGAGCGGATACAGC
GTGGTCGCCGTCCGGCTGAAGAACCAGAGCGATAAGCCAGTGGTGCTTGACCCTCGCCGCTTACAGGGGC
GTTTTTACAGCGCCACATTTCAACACCGTTGGTTAGGTGCGCAGGGGACGCCGGAGGATACCACTCTGCT
GTATCTGGTTTTCACAGGGCGGCCTGAAAACGCCTTCTTGCCCAGTGCGGTGATGGCGAAAAAGGGAGGT
CGATGA
 Primer design