SecReT4
Protein ID: 378980663
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45040
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4534453..4535106 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDG8VX66
KEGG IDkpm:KPHS_45040
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 6.5e-89, Aligned region: 6..203
Protein Sequence: 217 a.a.     [Download]
>gi|378980663|ref|YP_005228804.1| hypothetical protein KPHS_45040 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSRFKNALNARDAHIWTLRGTCVLLILVCLVLALGWMNAPRNLTIHQPPDLRSGSTRPWWEVPPSTVYAF
GFYVFQQLNSWPKDGEQDYPARIKSLSPYLTPECQTLLEDDARKRNFSGELRERVRGIYEIPGRGYRGDR
VEIVDRDHWVIRLDLTADEYYHNEPVKRALVRYPLKVVRWDVNPELNPFGLALDCFAAMPQRLEAAPVDV
PEKKGIF
 
Nucleotide Sequence: 654 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4535106-4534453 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
GTGAGCCGTTTCAAAAATGCCCTTAACGCCCGCGATGCGCATATCTGGACGCTGCGCGGAACCTGCGTTT
TGCTGATTCTGGTGTGCCTGGTGCTGGCCCTGGGCTGGATGAACGCGCCGCGCAACCTCACTATCCATCA
GCCGCCGGACCTGCGCAGCGGCAGCACCCGCCCCTGGTGGGAAGTGCCGCCCAGCACGGTATACGCGTTT
GGCTTCTACGTATTTCAGCAGTTGAACAGTTGGCCGAAGGATGGTGAACAGGATTATCCGGCCAGAATTA
AGTCTCTTTCCCCTTACCTGACCCCGGAATGCCAGACGTTACTGGAGGACGACGCGCGCAAGCGCAACTT
CTCCGGCGAACTGCGCGAGCGGGTGCGCGGTATCTATGAAATCCCCGGACGAGGTTACCGCGGCGATCGG
GTGGAGATTGTCGATCGCGACCATTGGGTTATCCGGCTCGACCTCACCGCCGATGAGTATTACCACAACG
AACCGGTCAAACGCGCGTTAGTTCGCTATCCGCTGAAGGTGGTGCGCTGGGACGTCAATCCGGAACTGAA
CCCGTTTGGCCTGGCGCTGGACTGCTTTGCCGCGATGCCGCAGCGCCTGGAAGCCGCCCCGGTCGATGTG
CCTGAGAAGAAGGGGATATTTTGA
 Primer design