SecReT4
Protein ID: 378980664
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45050
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4535103..4535474 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDG8VX67
KEGG IDkpm:KPHS_45050
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.8e-41, Aligned region: 2..114
Protein Sequence: 123 a.a.     [Download]
>gi|378980664|ref|YP_005228805.1| hypothetical protein KPHS_45050 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MATIQFMPDRLNAEPVVFRGFTTPELGLTALFSTLAGIVISLPFLFFSWVMIPTIALILPLLVIVFGGKV
LARIKRGKPENYLYRRLEAALVQWGLGNPRLILVSRRWSLRRSRAVIQLEVNL
 
Nucleotide Sequence: 372 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4535474-4535103 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGCGACGATTCAGTTCATGCCTGACAGGCTCAACGCTGAACCGGTCGTTTTCCGGGGGTTCACCACCC
CCGAATTAGGTTTGACCGCGTTGTTCAGCACGCTGGCAGGCATCGTTATCTCCCTGCCGTTCCTGTTTTT
TTCCTGGGTCATGATCCCAACGATTGCCCTCATTTTGCCGCTACTGGTGATTGTCTTCGGCGGCAAAGTG
CTGGCGCGGATCAAGCGCGGCAAGCCGGAAAACTACCTTTATCGTCGCCTTGAAGCGGCGCTCGTCCAGT
GGGGGCTGGGCAATCCCCGGCTAATTCTGGTGTCGCGCCGCTGGTCGCTGCGGCGGAGCAGGGCGGTGAT
ACAGCTGGAGGTGAACCTGTGA
 Primer design