SecReT4
Protein ID: 378980665
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45070
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4535484..4535837 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDG8VX68
KEGG IDkpm:KPHS_45070
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 2.7e-29, Aligned region: 28..114
Protein Sequence: 117 a.a.     [Download]
>gi|378980665|ref|YP_005228806.1| hypothetical protein KPHS_45070 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MNALFLRARKTVCTALVLGLSSPALADLPTVEGPKSKTDGTFYGKIAGYINDGLVLGGLVVAAVAFIVVA
MSCVSTFAEVRDGKATWGKFGAMVAVGVVLIVAVIWLANEAATIVAG
 
Nucleotide Sequence: 354 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4535837-4535484 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAACGCACTTTTTTTACGCGCCAGGAAGACGGTCTGTACCGCACTGGTTTTAGGACTCTCTTCCCCGG
CGCTGGCCGATTTGCCGACGGTCGAAGGCCCGAAGTCGAAAACCGACGGCACGTTCTATGGAAAGATCGC
CGGTTATATCAATGACGGTCTGGTGTTGGGCGGGTTAGTGGTCGCCGCCGTGGCCTTTATCGTGGTGGCG
ATGAGCTGCGTGTCCACGTTTGCCGAAGTCCGGGATGGCAAGGCGACTTGGGGCAAGTTTGGTGCCATGG
TGGCCGTGGGTGTGGTACTGATTGTCGCCGTGATCTGGCTTGCCAACGAAGCCGCCACCATCGTGGCCGG
ATAA
 Primer design