SecReT4
Protein ID: 378980667
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45080
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4536085..4536402 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDG8VX70
KEGG IDkpm:KPHS_45080
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.1e-27, Aligned region: 23..99
Protein Sequence: 105 a.a.     [Download]
>gi|378980667|ref|YP_005228808.1| hypothetical protein KPHS_45080 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MRMTKVRALCLSGALFTVLPCAQGSEKDELALVMKQLDQLQASLERAKVVAVQEHTSHRFYFDYPQATDD
IAKIKRGISTYLEPSRAQPVLPQDISGQYQREGEQ
 
Nucleotide Sequence: 318 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4536402-4536085 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGCGCATGACGAAAGTCCGGGCGCTTTGTCTGTCGGGGGCCTTATTCACCGTGCTTCCCTGTGCGCAGG
GCAGTGAAAAGGATGAACTGGCGTTAGTCATGAAACAGCTAGACCAGCTTCAGGCCAGTCTGGAGCGGGC
GAAGGTCGTCGCAGTACAGGAACACACATCACACCGCTTTTATTTTGACTACCCGCAGGCCACTGATGAT
ATCGCGAAAATCAAACGCGGCATCTCAACCTATCTTGAGCCTTCCCGCGCTCAGCCGGTACTGCCGCAGG
ATATCAGCGGCCAGTACCAACGCGAGGGGGAGCAATGA
 Primer design