SecReT4
Protein ID: 378980670
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45110
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4538363..4539010 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDG8VX73
KEGG IDkpm:KPHS_45110
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.9e-71, Aligned region: 15..212
Protein Sequence: 215 a.a.     [Download]
>gi|378980670|ref|YP_005228811.1| hypothetical protein KPHS_45110 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MLLVSLIFSLIVEYVGIAFFWPEEGALHSKAVMETESRYFSEEFTRSLLLSDPVVTVECWLTLAYQWLFV
DSGFLGWLNAPHADQGNDFTRTLNGGAAWLLVKLREYLLATVYVTLVFLIRVTILVLSVPLFVMVAAIGI
VDGLVRRDLRRYGAAYESSFIYHHAKRWIKPATCLPCVIYLSMPFAVYPNILLLPAALLLGLVISLTTGA
FKKYL
 
Nucleotide Sequence: 648 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4539010-4538363 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGTTACTCGTGTCGCTGATTTTCAGCCTGATCGTTGAGTATGTCGGCATTGCCTTCTTCTGGCCTGAAG
AAGGAGCCCTGCACAGCAAAGCGGTCATGGAGACGGAAAGCCGGTATTTCTCTGAAGAATTCACCCGCAG
CCTGCTGCTGTCTGACCCGGTGGTGACGGTAGAGTGTTGGCTGACGCTGGCGTATCAGTGGCTGTTTGTG
GACAGCGGTTTTCTGGGCTGGTTGAATGCCCCCCACGCAGATCAAGGCAACGACTTTACCCGGACGCTAA
ACGGCGGCGCGGCCTGGCTGCTGGTGAAGCTGCGGGAGTATCTGCTGGCGACGGTGTACGTGACGCTGGT
TTTTCTTATTCGGGTCACAATTTTGGTGCTGTCTGTGCCGCTGTTTGTGATGGTGGCAGCGATCGGCATC
GTGGACGGCCTGGTTCGGCGCGATTTGCGCCGCTACGGCGCGGCGTATGAGAGCAGCTTTATCTATCACC
ACGCCAAGCGCTGGATTAAACCGGCGACCTGTTTACCCTGCGTTATCTACCTGTCGATGCCGTTTGCGGT
ATATCCCAATATTCTTCTGCTGCCTGCGGCGCTGCTGCTGGGGTTGGTGATTTCGTTGACGACCGGGGCG
TTTAAGAAGTATTTGTGA
 Primer design