SecReT4
Protein ID: 378980672
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45130
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4539381..4541480 [-]
ProductTraG-family protein
Component typeTfc6
UniProt IDG8VX75
KEGG IDkpm:KPHS_45130
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.2e-16, Aligned region: 501..630
TrwB_AAD_bind [PF10412], Evalue: 2.1e-12, Aligned region: 180..225
TrwB_AAD_bind [PF10412], Evalue: 2.1e-12, Aligned region: 503..640
AAA_10 [PF12846], Evalue: 7.2e-11, Aligned region: 188..577
Protein Sequence: 699 a.a.     [Download]
>gi|378980672|ref|YP_005228813.1| TraG-family protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSDRYVIEALLRPAVELNTAVVSACASYVCVTAPWAIALAPSVSYVMAGALGIFAIKRTREGLRVLRYRR
NIRRLPRYVMTSRQVPVSQMKLFLGKGFLWEQRHTQRLLDTLRPEVARYVNPSWVYQAARRVEQRQEYRF
PTLCRLLASESAFNPVRPLPPVGGLPALHGIELDETNVLMDLRERVGHLLVLGTTRVGKTRLAELLITQD
IRRGDVVIVFDPKGDADLLKRMYAECQRAGRGDEFHVFHLGWPDISARYNAVGRFGRVSEVASRVAGQLS
DAGNSAAFKEFAWRFVNIIARALVALGQRPDFALIQRYVNNPGDLFEHYCESWLSQHHPDLWLTIENLTA
TLTERDVPRHMEGRSLRVVAIEHVLGSDAGKRVYDPVLDGLRSSVRYDQKYYDKIVASLLPLLEKLTSGK
TAQLISPNYSDLNDPRPIFDWQQVIRKKGVVYVGLDALSDPEVAAAVGNSMFADLVSVAGYIYKFGINDG
LPQQSGGNTPISLHCDEFSELMGDEFIPLINKGGGAGIQITAYTQTLPDIEAKIGNSAKAAQVVGNFNSL
VMLRVRHTETAELLTRQLPEVEVYTKTLVSGVTDISNPDQGSDFTSNVQDRVSSVRTPLITPANVINLPK
GQAFALLEGGRLWKLRMPLPAAGDDAFMPESISQIAGYMQKNYRTGDEWWSGGAMPGDRMIEEAEGEEE
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4541480-4539381 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
GTGAGCGATCGCTATGTGATTGAAGCCCTGCTGCGACCGGCGGTTGAACTGAATACCGCCGTGGTATCCG
CCTGCGCCAGCTATGTTTGCGTTACCGCGCCGTGGGCGATTGCTTTAGCGCCCAGCGTTAGCTACGTGAT
GGCCGGAGCGCTGGGGATATTCGCGATTAAGCGCACCCGCGAAGGGCTGCGGGTACTTCGCTATCGCCGT
AATATCCGGCGCTTACCCCGCTACGTGATGACCAGCCGTCAGGTGCCAGTGAGCCAGATGAAGCTGTTCC
TGGGAAAAGGCTTTTTATGGGAGCAGCGGCACACGCAGCGCCTGCTGGATACGTTACGCCCGGAGGTCGC
CAGATACGTAAACCCTTCCTGGGTTTATCAGGCGGCGCGGCGGGTTGAACAACGTCAGGAATATCGTTTT
CCGACCCTGTGCCGGTTACTGGCAAGCGAGAGCGCGTTTAATCCGGTAAGGCCTCTGCCGCCTGTGGGCG
GTTTACCGGCGCTGCACGGCATTGAGCTGGATGAAACCAATGTGCTGATGGACCTGCGCGAGCGGGTCGG
GCATTTACTGGTGTTGGGCACCACCCGGGTAGGGAAGACGCGCCTGGCTGAGTTACTGATTACTCAGGAT
ATTCGCCGGGGAGACGTGGTGATTGTGTTCGACCCCAAAGGGGATGCCGACCTGCTGAAAAGGATGTACG
CGGAGTGCCAGCGCGCCGGGCGCGGCGATGAGTTTCACGTCTTTCATCTGGGCTGGCCGGATATCTCTGC
GCGCTACAATGCTGTGGGAAGGTTCGGCAGAGTTTCGGAAGTAGCGAGTCGGGTCGCCGGGCAGCTCAGC
GATGCGGGGAACTCCGCCGCGTTTAAAGAATTTGCCTGGCGCTTTGTCAATATCATCGCACGGGCGCTGG
TCGCGCTGGGACAACGTCCGGACTTCGCGCTGATCCAGCGCTACGTTAACAACCCCGGCGATCTGTTTGA
ACACTATTGCGAAAGCTGGCTGAGCCAGCACCATCCCGACCTGTGGTTGACGATAGAAAACCTGACGGCG
ACGCTGACGGAGCGTGATGTTCCCCGTCATATGGAAGGGCGCTCCCTGCGTGTGGTGGCGATTGAACATG
TGCTGGGTAGCGACGCCGGAAAGCGGGTGTATGACCCGGTTCTGGACGGGCTGCGTTCCTCGGTGCGCTA
TGACCAGAAGTACTACGACAAAATTGTGGCTTCGCTGCTGCCGCTGCTGGAAAAGCTGACCTCCGGGAAG
ACGGCGCAGCTCATCTCTCCGAACTACAGTGACCTGAACGACCCACGCCCGATCTTTGACTGGCAGCAGG
TTATCCGCAAAAAGGGCGTGGTGTACGTCGGCCTGGATGCGCTCTCCGATCCTGAAGTGGCTGCGGCGGT
AGGTAACAGCATGTTTGCTGATTTGGTGTCGGTGGCGGGCTATATCTATAAGTTCGGCATTAATGACGGC
CTGCCGCAGCAGAGCGGCGGCAACACACCGATCAGCCTCCACTGTGACGAATTCAGTGAATTAATGGGGG
ACGAGTTCATTCCTCTGATTAATAAAGGGGGCGGCGCGGGGATCCAGATCACGGCCTACACCCAAACGCT
GCCGGATATCGAGGCGAAAATCGGTAACTCCGCCAAAGCGGCGCAGGTGGTGGGTAACTTCAATAGTCTG
GTTATGCTGCGGGTCCGCCATACGGAAACCGCTGAGCTACTGACCCGACAACTGCCGGAAGTGGAGGTGT
ATACCAAAACGCTGGTTTCCGGCGTGACTGACATTTCCAATCCCGATCAGGGCAGCGACTTCACCAGTAA
CGTTCAGGACAGGGTCAGCAGCGTGCGAACGCCGCTGATAACGCCCGCCAACGTTATTAATTTGCCAAAA
GGGCAGGCGTTTGCGCTGCTTGAAGGCGGGCGGCTCTGGAAATTAAGGATGCCGCTTCCAGCAGCAGGCG
ATGATGCCTTTATGCCGGAGAGCATCAGCCAGATCGCCGGATATATGCAGAAAAACTACCGCACCGGGGA
TGAGTGGTGGTCAGGCGGCGCGATGCCGGGCGACCGCATGATTGAAGAGGCAGAAGGAGAGGAAGAATGA
 Primer design