SecReT4
Protein ID: 378980673
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45140
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4541518..4542030 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDG8VX76
KEGG IDkpm:KPHS_45140
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 3.7e-47, Aligned region: 23..169
Protein Sequence: 170 a.a.     [Download]
>gi|378980673|ref|YP_005228814.1| hypothetical protein KPHS_45140 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MKSIYLLGLCCLFGNAHAGLNVIADLGGEPAAPYFDGINNQPNEFESPNPPEAAVLPAAPASLASVLPIS
TPELTPGSVEARRLGLPGMQPIFLLGNDPLSRRWLDERKESLRQLRAVGLVVNIEDEAAFGELQTLAGDI
ELLPVSGSDLAKRLGLQHYPVFISEKGIEQ
 
Nucleotide Sequence: 513 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4542030-4541518 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAAGAGCATTTACCTTTTGGGACTCTGTTGCCTGTTTGGCAATGCGCACGCCGGGCTGAACGTTATTG
CCGATTTGGGCGGGGAACCTGCCGCACCTTATTTTGACGGCATTAATAATCAGCCCAATGAATTTGAATC
ACCAAACCCGCCGGAGGCGGCTGTATTGCCCGCTGCACCCGCGTCACTGGCATCGGTATTGCCAATATCC
ACGCCTGAATTAACGCCCGGCAGCGTAGAGGCCCGCCGCCTCGGTTTACCAGGGATGCAGCCGATATTTT
TGTTGGGTAACGATCCGCTGTCCCGCCGTTGGCTGGATGAACGAAAGGAATCGCTGCGGCAGCTGCGGGC
CGTTGGGCTAGTGGTCAATATCGAGGACGAAGCGGCGTTTGGCGAGCTGCAAACGCTGGCCGGTGATATC
GAGCTGCTGCCGGTATCCGGCAGCGATCTGGCGAAGCGGCTGGGGTTGCAACACTACCCGGTATTCATCA
GCGAAAAGGGAATTGAACAATGA
 Primer design