SecReT4
Protein ID: 378980674
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45150
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4542027..4542596 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDG8VX77
KEGG IDkpm:KPHS_45150
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|378980674|ref|YP_005228815.1| hypothetical protein KPHS_45150 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MVARRVLMFLLLFPPLACAQSIPSGYRQIAEQENVPAEALYSLALTESAKKLAHGVRPWPWTINVAGIGY
RYASRDEAYQALLGFIRRYPLKRIDVGVAQVNLGWNGSRFSSYWHAFDPYTNLRVAARILRECYDAQPGS
WMQAAGCYHHPAGGKPARVYKAVVQRHLNTLNPVKPTAVSWVEPKRKTP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4542596-4542027 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGTTGCCCGTCGCGTTCTGATGTTCCTGCTATTGTTTCCCCCGTTGGCCTGCGCACAGTCGATTCCAT
CCGGCTACCGTCAGATTGCGGAACAGGAAAACGTACCTGCCGAAGCGCTGTACTCGCTGGCGCTGACCGA
ATCGGCCAAAAAGCTGGCCCATGGCGTTCGTCCGTGGCCGTGGACCATCAACGTTGCCGGAATCGGGTAT
CGTTATGCCAGCCGTGATGAGGCCTATCAGGCGTTGCTGGGGTTTATCCGGCGCTATCCCCTGAAGCGAA
TCGATGTGGGTGTCGCTCAGGTTAATCTGGGCTGGAACGGCAGCCGGTTTTCATCGTATTGGCACGCCTT
TGACCCCTACACCAATCTGCGCGTCGCGGCGCGGATCCTACGCGAATGCTACGACGCCCAACCGGGAAGC
TGGATGCAGGCCGCCGGTTGTTACCATCATCCTGCGGGCGGCAAGCCGGCCCGCGTCTATAAAGCGGTTG
TTCAACGCCATCTGAATACTCTGAACCCGGTAAAGCCCACGGCGGTGAGCTGGGTAGAGCCGAAGAGAAA
AACACCATGA
 Primer design