SecReT4
Protein ID: 378980675
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45160
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4542575..4543192 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDG8VX78
KEGG IDkpm:KPHS_45160
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 205 a.a.     [Download]
>gi|378980675|ref|YP_005228816.1| hypothetical protein KPHS_45160 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MAGKLEQANTRKSAQTWGLTDEEWQRYQALMNGRRGVFSPDLDPITALGIEARTAEERRRFAELSVQQDF
KRVEAELAFQREVDAAWKRLYPHILPIGAGMGSAPAQPRSHGRLALFVKADCPPCDKTLTKLLASQKPFD
IYLVGSEGQDAKVREWASRRHIPAERVKTRAITLNHDAGRWLKLGKGQMPVVLEQGENGWLPVAF
 
Nucleotide Sequence: 618 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4543192-4542575 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
GTGGCCGGAAAGCTTGAGCAGGCGAACACCCGTAAAAGCGCTCAGACATGGGGACTGACCGACGAGGAGT
GGCAACGCTATCAGGCGTTAATGAATGGACGGCGCGGCGTATTCTCTCCCGATCTGGACCCGATTACGGC
GCTGGGCATTGAAGCCAGAACGGCGGAAGAGCGCCGCCGCTTTGCCGAACTGTCCGTCCAGCAGGACTTT
AAGCGCGTGGAGGCCGAGCTGGCGTTTCAGCGGGAGGTCGACGCGGCGTGGAAACGGCTTTACCCCCATA
TTCTGCCGATTGGCGCAGGTATGGGCAGCGCGCCAGCTCAGCCCCGGAGTCATGGCCGTCTGGCGCTGTT
TGTCAAAGCGGACTGCCCGCCCTGTGATAAAACGCTGACGAAGCTGCTCGCCAGCCAGAAGCCGTTTGAT
ATTTATCTGGTCGGTAGCGAAGGCCAGGACGCGAAGGTACGTGAGTGGGCGAGCAGGCGGCATATTCCCG
CTGAACGCGTAAAAACGCGGGCGATTACGCTCAACCATGACGCTGGTCGCTGGCTGAAGTTAGGCAAAGG
CCAAATGCCCGTGGTGCTGGAACAGGGGGAAAACGGATGGTTGCCCGTCGCGTTCTGA
 Primer design