SecReT4
Protein ID: 378980677
T4SS name [ID]Tfc [810]
Gene symbol-
Locus tagKPHS_45180
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T4SS(s) in this replicon]
Location [Strand]4544046..4544615 [-]
Producttype IV B pilus protein
Component typeTfc2
UniProt IDG8VX80
KEGG IDkpm:KPHS_45180
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|378980677|ref|YP_005228818.1| type IV B pilus protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MKYHRYLLCVIGVIVIGGCAPKQKLQQPALSLSSTLNSNVQSAADDVYQRENAPQVVRYDRYLLVSTDPS
AAQRAPLEQIIDIRIPASLTPTVADAMRYALKQSGYSLCAVTSSNAVLYNQSLPAVHYQLGPMRLNTALQ
VMAGSAWQLEADDVQRIVCHSLRDGYQLPKAETSPSRFLTKPTLKGNAS
 
Nucleotide Sequence: 570 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c4544615-4544046 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAAATATCACCGGTATTTGCTCTGCGTGATAGGGGTTATTGTGATTGGCGGCTGCGCGCCAAAGCAAA
AGTTACAACAACCAGCGTTATCCCTTTCCAGTACGCTAAACAGCAACGTTCAGTCTGCGGCTGATGATGT
TTACCAGCGCGAAAACGCGCCGCAGGTGGTGCGCTACGATCGCTACCTGCTGGTTAGTACCGATCCCAGC
GCCGCCCAGCGCGCGCCGCTGGAACAAATCATTGATATCCGCATTCCCGCATCGCTGACGCCGACCGTAG
CTGATGCCATGCGCTACGCCTTAAAACAGTCGGGTTACAGCCTCTGCGCCGTCACTTCATCCAATGCCGT
TCTGTATAACCAGTCTCTCCCGGCGGTGCATTACCAGCTCGGCCCTATGCGGCTGAACACGGCGCTACAG
GTCATGGCGGGTAGCGCCTGGCAACTGGAAGCTGACGACGTACAGCGTATTGTCTGCCATAGCCTGAGGG
ACGGGTACCAGCTGCCAAAGGCTGAAACATCGCCCTCTCGTTTCCTCACCAAACCAACGTTGAAAGGGAA
CGCATCATAA
 Primer design